Recombinant Rat Proteinase-activated receptor 3 (F2rl2)

Shipped with Ice Packs
In Stock

Description

Molecular Overview

Recombinant Rat F2rl2 is a full-length transmembrane protein (UniProt ID: Q920E1) expressed in E. coli with an N-terminal His tag for purification . Key features include:

PropertyDetails
Amino Acid Range38–368 (mature protein)
Molecular Weight~42 kDa (estimated based on human homolog)
Post-Translational ModificationsMulti-pass membrane protein with conserved G-protein coupled receptor (GPCR) domains
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose; stable at -20°C/-80°C

The receptor contains a thrombin cleavage site at Lys38/Thr39, exposing the tethered ligand TFRGAP, which is unique in its inability to independently activate signaling .

Functional Roles

F2rl2 operates as a cofactor for PAR4 activation by thrombin, facilitating G-protein signaling pathways linked to platelet aggregation and endothelial cell responses . Key functional insights include:

RoleMechanism
HemostasisEnhances thrombin-induced PAR4 cleavage in platelets
Cellular SignalingCouples with Gq proteins to stimulate phosphoinositide hydrolysis
Species SpecificityExpressed in rat megakaryocytes but absent in mature platelets

Unlike PAR1 and PAR4, PAR3 lacks intrinsic signaling capacity but amplifies thrombin’s proteolytic activation of other PARs .

Research Applications

Recombinant Rat F2rl2 is utilized in:

  • In vitro thrombin signaling assays

  • Platelet activation studies (via PAR3-PAR4 crosstalk)

  • Structural analyses of GPCR activation mechanisms

Production and Quality Control

  • Expression System: E. coli ensures high yield and cost-effectiveness .

  • Purification: Affinity chromatography via His tag .

  • Reconstitution: Recommended in sterile water with 5–50% glycerol to prevent aggregation .

Challenges and Limitations

  • Inactive Tethered Ligand: The TFRGAP sequence fails to induce signaling, limiting standalone functional studies .

  • Species-Specific Expression: PAR3’s role varies between rodents and humans, complicating translational research .

Future Directions

Current research focuses on:

  • PAR3’s role in non-hematopoietic tissues (e.g., gut, thyroid) .

  • Development of PAR3-specific modulators for thrombosis therapy .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
F2rl2; Par3; Proteinase-activated receptor 3; PAR-3; Coagulation factor II receptor-like 2; Thrombin receptor-like 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
38-368
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SFNGNEHSFEEFPLSDIEGWTGATTTIKAKCPEESITTLHVNNATMGYLRSSLSTKVIPA IYILVFVIGVPANIVTLWKLSSRTKSICLVIFHTNLAIADLLFCVTLPFKIAYHLNGNDW VFGEVMCRVTTVAFYGNMYCAILILTCMGINRYLATVHPFTYRKLPKRNFTLLMCGVVWV MVVLYMLPLAILKQEYHLVQPGITTCHDVHDTCESPLPFQFYYFVSLAFFGFLIPFVVSV FCYTTLIHKLNAQDRKWLRYIKAVLLILVIFTICFAPTNIILIIHHANYYYSNTDSLYFM YLIALCLGSLNSCLDPFLYFIMSKIVDQLTS
Uniprot No.

Target Background

Function
Receptor for activated thrombin coupled to G proteins, stimulating phosphoinositide hydrolysis.
Gene References Into Functions
  • Expression of protease-activated receptor 3 remains largely unchanged in the hippocampus following severe ischemic insult. PMID: 12165407
  • Par-3 mRNA is expressed in the developing rat eye and adult retina; however, its upregulation after optic nerve crush is delayed compared to Par-1, Par-2, and Par-4. PMID: 12836167
  • In a rat model of lipopolysaccharide-induced acute lung injury, PAR 3 is regulated transcriptionally and likely plays a distinct role. PMID: 17136598
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteinase-activated receptor 3 (F2rl2) and what are its alternative names?

Proteinase-activated receptor 3 (PAR-3) is encoded by the F2rl2 gene and is also known as coagulation factor II receptor-like 2 or thrombin receptor-like 2. It belongs to the large family of 7-transmembrane receptors that couple to G proteins and is specifically a member of the protease-activated receptor family . This receptor is part of a sophisticated signaling system where proteases function as signaling molecules that control cellular functions through receptor cleavage . The canonical human protein has 374 amino acid residues with a molecular mass of approximately 42.5 kDa, and its subcellular localization is primarily in the cell membrane .

What is the basic structure and functional mechanism of F2rl2?

F2rl2 contains two exons, with the second exon encoding the protease cleavage site essential for receptor activation . Like other PARs, it functions through a unique activation mechanism where proteolytic cleavage of its extracellular amino terminus by thrombin creates a new amino terminus that acts as a tethered ligand, binding to and activating the receptor itself . The canonical thrombin cleavage site of human PAR3 is at Lys38/Thr39, followed by a hirudin-like domain that facilitates interaction with thrombin . Upon cleavage, the newly exposed N-terminal sequence TFRGAP is revealed, though interestingly, synthetic peptides mimicking this sequence fail to initiate signaling responses via PAR3, suggesting a more complex activation mechanism than seen in other PARs .

How does F2rl2 expression differ across tissues?

F2rl2 shows a distinctive tissue expression pattern with particularly high expression in the megakaryocytes of the bone marrow, and lower expression in mature megakaryocytes and platelets . Beyond the hematopoietic system, F2rl2 exhibits biased expression in adipose tissue, stomach, thyroid, and colon . This tissue-specific expression pattern suggests specialized functions in different physiological contexts, potentially coordinating responses to proteolytic stimuli across multiple organ systems. The receptor is also present in endothelial cells, suggesting a role in vascular biology .

How does F2rl2 interact with thrombin and facilitate PAR4 activation?

F2rl2 demonstrates a sophisticated interaction mechanism with thrombin that enables it to enhance PAR4 activation. When cleaved by thrombin, F2rl2 binds to the exosite I of thrombin (similar to hirudin binding), while leaving the active site accessible . This interaction creates a configuration that enhances the diffusion of PAR4 to the active site of thrombin, favoring PAR4 hydrolysis and activation .

This mechanism is particularly important in mouse platelets, which lack PAR1. In this context, cleaved PAR3 binds the exosite I of thrombin, causing a structural shift in the thrombin 60-loop and a flip of Trp60d that opens the active site for PAR4 interaction . The molecular details of this interaction provide insight into how PAR3 functions as a cofactor rather than an independent signaling receptor in certain physiological settings.

What are the key differences in F2rl2 function between species, particularly between rat and human?

The role of F2rl2 varies significantly between species, with notable differences between rodents and humans. In mouse platelets, which lack PAR1, F2rl2 (PAR3) plays a critical cofactor role in facilitating PAR4 activation by thrombin . The cleaved PAR3 enhances PAR4 cleavage through the allosteric mechanism described previously.

In humans, platelets express both PAR1 and PAR4, and PAR1 primarily fulfills the cofactor role that PAR3 serves in mice. Human PAR1 and PAR4 can form heterodimers, with cleaved PAR1 facilitating the association between platelets and thrombin while leaving the active site free to bind PAR4 . These species differences are critical considerations in experimental design when using rat or mouse models to study mechanisms that may ultimately be applied to human biology.

What are the optimal methods for detecting and quantifying F2rl2 expression in tissue samples?

For detecting and quantifying F2rl2 expression in tissue samples, researchers have several effective methodologies at their disposal:

  • Immunohistochemistry (IHC): This is the most widely used application for F2rl2 antibodies and allows visualization of protein expression patterns within tissue architecture . For optimal results, use validated anti-F2rl2 antibodies specific to the N-terminal region, which can detect the receptor before proteolytic activation.

  • Western Blot: This technique allows quantification of total F2rl2 protein expression and can distinguish between the full-length receptor (~42.5 kDa) and cleaved forms . Sample preparation should include appropriate protease inhibitors to prevent artifactual receptor cleavage during processing.

  • ELISA: For quantitative analysis of F2rl2 levels across multiple samples, ELISA provides a high-throughput approach . Both sandwich and competitive ELISA formats can be effective depending on the specific research question.

  • Immunofluorescence: This method is valuable for examining subcellular localization and potential colocalization with other proteins . Combined with confocal microscopy, it can reveal receptor trafficking and membrane distribution patterns.

  • qRT-PCR: For mRNA expression analysis, design primers spanning the exon-exon junction to avoid genomic DNA amplification. This approach is particularly valuable for examining transcriptional regulation of F2rl2 across different tissues or experimental conditions.

What considerations are important when designing experiments with recombinant rat F2rl2?

When working with recombinant rat F2rl2, several crucial experimental design considerations should be addressed:

  • Expression System Selection: Choose an expression system that ensures proper post-translational modifications, particularly glycosylation, which can affect receptor folding and function. Mammalian expression systems (HEK293, CHO cells) generally provide more physiologically relevant modifications than bacterial or insect cell systems.

  • Signal Sequence Optimization: Ensure the construct includes an appropriate signal sequence for proper membrane targeting and integration. The native signal sequence may be replaced with optimized versions if expression efficiency is low.

  • Epitope Tag Placement: If incorporating epitope tags (His, FLAG, etc.), position them carefully to avoid interference with the thrombin cleavage site (between Lys38/Thr39 in human PAR3) or the tethered ligand sequence. C-terminal tags generally pose less risk of functional interference.

  • Purification Strategy: Develop a purification strategy that maintains the native conformation of the receptor. Detergent selection is critical - mild non-ionic detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often preserve receptor structure better than harsher ionic detergents.

  • Functional Validation: Verify that the recombinant protein retains thrombin binding and cofactor activity for PAR4 activation using appropriate functional assays.

  • Species Considerations: Be aware of the functional differences between rat F2rl2 and human PAR3, particularly regarding their roles in platelet function, when designing translational experiments.

What are the most effective methods for studying F2rl2 activation and signaling?

Studying F2rl2 activation and signaling requires specialized approaches due to its unique cofactor function:

  • Phosphoinositide Hydrolysis Assays: Measure PIP2 hydrolysis following thrombin stimulation to assess receptor activation. This can be performed using radioisotope-labeled lipids or fluorescent biosensors in live cells expressing F2rl2 .

  • Ca²⁺ Flux Measurements: Monitor intracellular calcium mobilization using fluorescent calcium indicators (Fura-2, Fluo-4) or genetically encoded calcium indicators (GCaMPs) in response to thrombin stimulation .

  • Receptor Cleavage Analysis: Use antibodies specific to the N-terminal region to track proteolytic cleavage of F2rl2 by thrombin or other proteases. Western blotting with antibodies recognizing different epitopes can distinguish between cleaved and uncleaved receptors.

  • Co-immunoprecipitation Studies: Investigate the formation of complexes between F2rl2 and PAR4 or other signaling partners through co-immunoprecipitation followed by Western blotting or mass spectrometry.

  • Allosteric Modulation Assays: Examine how F2rl2 enhances PAR4 activation by comparing PAR4 activation kinetics in the presence or absence of F2rl2. This can be done using cells co-expressing both receptors with appropriate readouts for PAR4 activation.

  • BRET/FRET Approaches: Employ bioluminescence or fluorescence resonance energy transfer techniques to monitor protein-protein interactions between F2rl2 and potential binding partners in real-time within living cells.

How can F2rl2 knockout or knockdown models be effectively generated and validated?

Creating and validating F2rl2 knockout or knockdown models requires careful attention to both technical aspects and functional validation:

  • CRISPR/Cas9 Knockout Methodology:

    • Design sgRNAs targeting conserved regions within the F2rl2 coding sequence, particularly exon 2 containing the thrombin cleavage site.

    • Screen clones using both genomic PCR and protein detection methods (Western blot, immunofluorescence).

    • Sequence verify the mutation site to confirm frameshift or premature stop codons.

    • Check for potential off-target effects through whole genome sequencing or targeted sequencing of predicted off-target sites.

  • siRNA/shRNA Knockdown Approach:

    • Design multiple siRNA sequences targeting different regions of F2rl2 mRNA.

    • Validate knockdown efficiency at both mRNA (qRT-PCR) and protein levels.

    • Include appropriate scrambled control sequences and rescue experiments with knockdown-resistant constructs.

  • Functional Validation Assays:

    • Assess thrombin-induced signaling responses, particularly the cofactor function for PAR4 activation.

    • In platelet models, measure aggregation responses to low and high concentrations of thrombin.

    • Examine changes in PAR4 activation kinetics in the absence of F2rl2.

  • Considerations for Compensatory Mechanisms:

    • Monitor potential upregulation of other PAR family members (PAR1, PAR2, PAR4) that might compensate for F2rl2 loss.

    • Consider using inducible knockout systems to avoid developmental adaptations.

This systematic approach ensures the generation of valid models for studying F2rl2 function in various physiological and pathological contexts.

What are the key considerations when investigating F2rl2 in thrombosis and hemostasis research?

Investigating F2rl2 in thrombosis and hemostasis research requires attention to several critical aspects:

  • Species-Specific Functions: The different roles of F2rl2 in human versus rodent platelet function must be carefully considered. In mice, F2rl2 serves as a critical cofactor for PAR4 activation, while in humans, PAR1 predominantly serves this function .

  • Platelet Preparation Protocols: When isolating platelets for F2rl2 studies, use anticoagulants that minimally interfere with PAR function (such as sodium citrate rather than heparin, which can affect thrombin-receptor interactions).

  • Thrombin Concentration Range: Use physiologically relevant thrombin concentrations that distinguish between direct PAR4 activation and PAR4 activation mediated by the F2rl2 cofactor effect. Typically, lower thrombin concentrations (0.1-1 nM) will highlight the cofactor role of F2rl2.

  • In Vitro Thrombosis Models:

    • Platelet aggregation assays with varying thrombin concentrations

    • Thrombus formation under flow conditions using parallel plate flow chambers

    • Clot retraction and strength measurements

  • In Vivo Thrombosis Models:

    • Ferric chloride-induced vascular injury

    • Laser-induced microvascular injury

    • Mechanical vessel injury models

  • Combined Approaches: Use combined in vitro and in vivo approaches to comprehensively assess the role of F2rl2 in thrombosis and hemostasis.

How does F2rl2 function differ in pathological states compared to normal physiology?

The functional alterations of F2rl2 in pathological states compared to normal physiology represent an emerging area of research:

  • Inflammatory Conditions: In inflammatory settings, increased protease activity from sources beyond the coagulation cascade (neutrophil elastase, cathepsins, etc.) may activate or modulate F2rl2 function differently than thrombin. While primarily known for its role in hemostasis, F2rl2 may participate in inflammatory signaling networks during pathological states.

  • Cancer Biology: Based on insights from related receptors like F2R (PAR1), investigating F2rl2 in cancer contexts may reveal important regulatory roles. Recent research has identified F2R as a potential biomarker in gastric adenocarcinoma , suggesting that related receptors like F2rl2 might have similar implications in malignancy.

  • Tissue-Specific Pathologies: Given the biased expression of F2rl2 in tissues such as fat, stomach, thyroid, and colon , investigating its role in pathologies affecting these tissues (inflammatory bowel disease, thyroid disorders, obesity) could reveal novel functions beyond hemostasis.

  • Vascular Pathologies: In endothelial dysfunction states, alterations in F2rl2 expression or function may contribute to vascular pathophysiology, potentially modifying inflammatory responses or vascular permeability in conjunction with other PARs.

  • Receptor Expression Regulation: Pathological conditions may alter the expression levels of F2rl2, potentially disrupting the balance between different PAR family members and changing cellular responsiveness to proteolytic stimuli.

What are common technical challenges when working with recombinant F2rl2 and how can they be addressed?

Researchers working with recombinant F2rl2 frequently encounter several technical challenges that require specific solutions:

  • Low Expression Yields:

    • Optimize codon usage for the expression system being used

    • Include chaperon proteins to assist with proper folding

    • Use expression vectors with strong promoters designed for membrane proteins

    • Consider stable cell line generation rather than transient expression

  • Receptor Inactivation During Purification:

    • Maintain strict temperature control during all purification steps (4°C)

    • Include protease inhibitor cocktails to prevent unwanted proteolysis

    • Use glycerol (10-20%) in buffers to stabilize protein structure

    • Consider purifying in the presence of ligands or antagonists to stabilize certain conformations

  • Verifying Correct Folding:

    • Employ circular dichroism spectroscopy to assess secondary structure

    • Use ligand binding assays to confirm functional conformation

    • Consider limited proteolysis assays to verify appropriate structural accessibility

  • Aggregation Problems:

    • Screen multiple detergents for optimal solubilization

    • Use size exclusion chromatography to separate aggregates

    • Add specific lipids that promote receptor stability

    • Consider nanodiscs or other membrane mimetics for maintaining native conformation

  • Functional Assessment Challenges:

    • Develop cell-based assays that specifically measure F2rl2's cofactor activity

    • Use PAR4-expressing reporter cells to measure enhanced activation in the presence of F2rl2

    • Implement surface plasmon resonance to measure thrombin binding properties

What advanced analytical techniques are most informative for studying F2rl2 structure-function relationships?

Several sophisticated analytical approaches provide valuable insights into F2rl2 structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Allows visualization of F2rl2 structure in different activation states

    • Can reveal conformational changes induced by thrombin binding

    • Particularly valuable for examining complexes between F2rl2 and PAR4 or thrombin

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps regions of conformational flexibility and solvent accessibility

    • Identifies binding interfaces between F2rl2 and interaction partners

    • Monitors structural changes upon thrombin cleavage or during cofactor activity

  • Site-Directed Mutagenesis Combined with Functional Assays:

    • Systematic mutations of key residues in the thrombin cleavage site (Lys38/Thr39)

    • Modification of the hirudin-like domain to alter thrombin binding

    • Mutation of transmembrane domains to probe G-protein coupling interfaces

  • Computational Molecular Dynamics Simulations:

    • Model receptor behavior in membrane environments

    • Simulate conformational changes during activation

    • Predict effects of mutations on receptor function

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • Measure binding kinetics between F2rl2 and thrombin or other proteases

    • Assess how mutations affect binding affinities

    • Characterize the effects of potential antagonists or inhibitors

  • FRET-Based Conformational Sensors:

    • Design F2rl2 constructs with strategically placed fluorophores to detect conformational changes

    • Monitor real-time structural changes upon thrombin exposure

    • Examine how the cofactor function affects PAR4 conformation

How can contradictory findings about F2rl2 function be reconciled in experimental design?

Addressing contradictory findings about F2rl2 function requires a systematic approach to experimental design and interpretation:

  • Species Differences Consideration:

    • Clearly distinguish between species when interpreting results (rat vs. mouse vs. human)

    • Consider that PAR3 function differs significantly between rodents and humans

    • Design parallel experiments in both rodent and human systems when possible

  • Expression Level Variations:

    • Quantify receptor expression levels across experimental systems

    • Consider that overexpression may lead to non-physiological functions or interactions

    • Use inducible expression systems to test function across a range of expression levels

  • Context-Dependent Signaling:

    • Examine F2rl2 function in different cell types where the complement of signaling partners may vary

    • Investigate how different protease concentrations affect signaling outcomes

    • Consider the impact of the inflammatory microenvironment on receptor function

  • Methodological Standardization:

    • Develop standardized protocols for key assays to facilitate comparison across studies

    • Include appropriate positive and negative controls in all experiments

    • Validate key findings using multiple independent methodologies

  • Receptor Dimerization and Complex Formation:

    • Investigate how homo- and heterodimerization affect F2rl2 function

    • Examine whether contradictions might arise from different receptor complex formations

    • Consider the impact of other membrane proteins on F2rl2 behavior

By systematically addressing these factors, researchers can develop a more cohesive understanding of F2rl2 function across different experimental contexts.

What are the most promising therapeutic applications targeting F2rl2?

While therapeutic targeting of F2rl2 remains in early stages, several promising directions emerge from current understanding:

  • Antiplatelet Applications:

    • Development of specific antagonists that disrupt the cofactor function of F2rl2 for PAR4 activation

    • Design of peptides or small molecules that target the thrombin binding site on F2rl2

    • Creation of bispecific inhibitors targeting both F2rl2 and PAR4 interaction interfaces

  • Tissue-Specific Applications:

    • Targeting F2rl2 in tissues where it shows biased expression (fat, stomach, thyroid, colon)

    • Development of gut-specific F2rl2 modulators for inflammatory bowel conditions

    • Exploration of F2rl2 targeting in thyroid disorders based on its expression pattern

  • Diagnostic Applications:

    • Development of imaging agents targeting F2rl2 for detection of receptor upregulation in pathological states

    • Creation of biomarker assays measuring soluble or cleaved F2rl2 fragments

  • Cancer Therapeutics:

    • Investigation of F2rl2 as a potential target in malignancies, similar to other PAR family members like F2R in gastric cancer

    • Development of approaches to modulate protease-receptor interactions in the tumor microenvironment

  • Novel Drug Delivery Approaches:

    • Exploitation of the unique activation mechanism of F2rl2 for targeted drug delivery strategies

    • Design of protease-activated prodrugs that become active in environments with F2rl2 expression

What are key unresolved questions in F2rl2 biology that warrant further investigation?

Several fundamental questions about F2rl2 biology remain unresolved and represent important areas for future research:

  • Independent Signaling Capability:

    • Does F2rl2 possess independent signaling capacity beyond its cofactor role?

    • What explains the failure of mimetic peptides to activate F2rl2 signaling despite receptor cleavage?

    • Are there specific cellular contexts where F2rl2 signals independently?

  • Protease Specificity:

    • Beyond thrombin, what other proteases can effectively cleave and modulate F2rl2 function?

    • How does the specificity profile differ across species?

    • What determines protease recognition and cleavage efficiency?

  • Tissue-Specific Functions:

    • What is the functional significance of F2rl2 expression in non-hematopoietic tissues?

    • Does F2rl2 serve different roles in different tissues?

    • How is F2rl2 expression regulated in a tissue-specific manner?

  • Receptor Trafficking and Regulation:

    • What mechanisms control F2rl2 trafficking to and from the cell surface?

    • How is receptor expression regulated under pathological conditions?

    • What is the fate of the cleaved receptor following activation?

  • Evolutionary Significance:

    • Why has F2rl2 evolved different functions across species?

    • What evolutionary pressures have shaped its structure and function?

    • How does the unique cofactor role of F2rl2 provide evolutionary advantages?

  • Structural Determinants of Function:

    • What structural features enable F2rl2 to function as a cofactor rather than a primary signaling receptor?

    • How does the short cytoplasmic domain influence its signaling properties?

    • What conformational changes occur during thrombin binding and receptor cleavage?

What emerging technologies will advance F2rl2 research in the next decade?

Several cutting-edge technologies are poised to significantly advance F2rl2 research in the coming years:

  • Cryo-EM for Membrane Protein Complexes:

    • Advances in cryo-EM resolution will enable detailed structural studies of F2rl2 in complex with thrombin and PAR4

    • Visualization of conformational changes during the cofactor function

    • Structural insights into species-specific differences in receptor function

  • CRISPR-Based Genomic Editing:

    • Development of knock-in models with fluorescently tagged endogenous F2rl2

    • Creation of precise point mutations to study structure-function relationships

    • Base editing approaches to introduce clinically relevant polymorphisms

  • Single-Cell Multi-Omics Analyses:

    • Integration of transcriptomics, proteomics, and metabolomics at single-cell resolution

    • Characterization of F2rl2 expression patterns in rare cell populations

    • Identification of cell-specific signaling networks associated with F2rl2

  • Advanced In Vitro Tissue Models:

    • Organ-on-chip platforms incorporating F2rl2-expressing cells

    • 3D tissue models that recapitulate the native microenvironment

    • Patient-derived organoids for studying F2rl2 function in human tissues

  • Proteomics Technologies:

    • Proximity labeling approaches to identify novel F2rl2 interaction partners

    • Quantitative phosphoproteomics to map signaling networks

    • Cross-linking mass spectrometry to characterize protein complexes

  • Artificial Intelligence Applications:

    • AI-driven prediction of F2rl2 structural changes upon activation

    • Machine learning approaches to identify novel F2rl2 modulators

    • Computational models of receptor dynamics in different cellular contexts

These emerging technologies will collectively enable a more comprehensive understanding of F2rl2 biology and potentially lead to novel therapeutic approaches targeting this receptor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.