Recombinant Rat Proteinase-activated receptor 4 (F2rl3)

Shipped with Ice Packs
In Stock

Description

Research Applications and Findings

Recombinant Rat PAR4 is pivotal in studying thrombosis, inflammation, and nociception:

Platelet Activation and Thrombosis

  • PAR4 activation induces sustained platelet aggregation via P-selectin release and GPIIb/IIIa activation .

  • SNPs in F2rl3 (e.g., rs773857) correlate with increased perioperative myocardial injury (OR 2.4, p=0.004) due to hyperreactive platelets .

Inflammation and Pain

  • PAR4 sensitizes joint afferents via bradykinin B2 receptor-dependent mechanisms, implicating it in arthritis-related pain .

  • In PAR4−/− mice, reduced neutrophil infiltration and cytokine release are observed in inflammatory models .

Cellular Signaling Studies

  • Recombinant PAR4 is used to map thrombin-induced ERK/MAPK and NF-κB pathways in vascular cells .

Table 3: Expression Systems and Applications

ConstructApplicationsSupplier
Full-length (E. coli)Structural studies, ligand bindingCUSABIO
GST-tagged (AA 18–82)Immunoassays, epitope mappingAntibodies-Online
MBP-fused (AA 48–78)Antibody development, flow cytometryPMC

Future Directions

Ongoing research focuses on:

  • PAR4’s role in cancer metastasis and neuroinflammation .

  • Development of dual PAR1/PAR4 inhibitors for safer anticoagulation .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery timelines, please contact your local distributors.
Note: All protein shipments include standard blue ice packs. If dry ice packaging is required, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein using deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. You can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
F2rl3; Par4; Proteinase-activated receptor 4; PAR-4; Coagulation factor II receptor-like 3; Thrombin receptor-like 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
59-395
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
GFPGKPCANNSDTLELPASSEALLLGWVPTRLVPAIYGLVVVVGLPANGLALWVLATRVP RLPSTILLMNLAVADLLLALVLPPRLVYHLRGQRWPFGEAACRVATAALYGHMYGSVLLL AAVSLDRYLALVHSLRARALRGQRLTTILCLVAWLSAATLVLPLTFHRQTFLLAGSDRML CHDALPLAEQTSHWRPAFICLAVLGCFVPLLAMVLCYGATLRALAANGQRYSHAVRLTAL VLFSAVAAFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEF REKVRAMLCRQLKASSSSQASREAGSRGTAICSSTLL
Uniprot No.

Target Background

Function
Receptor for activated thrombin or trypsin coupled to G proteins that stimulate phosphoinositide hydrolysis. It may play a role in platelet activation.
Gene References Into Functions
  1. Activation of PAR4 upregulates the expression of CGRP mRNA and protein levels in dorsal root ganglion neurons PMID: 24105611
  2. PAR 4 is regulated at the transcriptional level in a rat model of lipopolysaccharide induced acute lung injury and probably has a distinct role. PMID: 17136598
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Proteinase-activated receptor 4 (F2rl3) and how is it activated?

Proteinase-activated receptor 4 (F2rl3) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. It belongs to the protease-activated receptor family and is activated through a distinctive mechanism involving proteolytic cleavage of its extracellular amino terminus. This cleavage generates a new amino terminus that functions as a tethered ligand, activating the receptor through an intramolecular binding mechanism .

PAR4 can be activated by several proteases including thrombin, trypsin, and cathepsin G. Additionally, researchers can selectively activate PAR4 using synthetic peptides known as PAR4-activating peptides (PAR4-AP), which mimic the tethered ligand sequence without requiring proteolytic cleavage .

How does PAR4 structure differ from other PAR family members?

PAR4 exhibits several structural distinctions from other PAR family members that contribute to its unique signaling properties:

  • C-terminus length: PAR4 possesses a shorter C-terminus compared to both PAR1 and PAR2 .

  • Phosphorylation sites: PAR4 lacks many of the phosphorylation sites that are necessary for the desensitization of PAR1 and PAR2 .

  • Internalization kinetics: Due to the structural differences mentioned above, agonist-triggered phosphorylation and subsequent receptor internalization occur significantly slower for PAR4 than for PAR1 or PAR2 .

These structural differences result in prolonged intracellular signaling downstream of PAR4 activation, representing a critical functional distinction from other PAR family members .

What techniques can be used to detect PAR4 expression in rat tissues?

Several techniques are available for detecting PAR4 expression in rat tissues:

  • Semi-quantitative duplex RT-PCR: This method can be used to detect PAR4 mRNA in rat dorsal root ganglia (DRG). The procedure involves:

    • Isolating mRNA using TRIzol reagent

    • DNase I treatment to remove genomic DNA

    • Reverse transcription to obtain cDNA

    • PCR amplification using specific primers for PAR4 and a housekeeping gene (GAPDH) as an internal control

  • Immunohistochemistry: This technique enables visualization of PAR4 protein expression in sensory neurons. The protocol involves:

    • Fixation of cultured neurons in 4% formaldehyde

    • Washing and incubation in PBS containing 5% normal goat serum and 0.1% saponin

    • Incubation with appropriate antibodies to detect PAR4

  • ELISA: Sandwich ELISA kits are available for the quantitative detection of F2rl3 in rat samples including serum, plasma, and tissue homogenates .

What are the performance characteristics of F2rl3 ELISA detection methods?

When using ELISA for F2rl3 detection, researchers should be aware of the following performance metrics:

Recovery rates for different matrices:

MatrixRecovery Range (%)Average (%)
Serum (n=5)89-10294
EDTA Plasma (n=5)88-10497
Heparin Plasma (n=5)87-10498

Linearity of dilution:

Sample1:21:41:8
Serum (n=5)86-105%91-101%80-94%
EDTA Plasma (n=5)90-102%87-93%80-98%
Heparin Plasma (n=5)93-102%82-99%84-100%

Precision:

  • Intra-Assay: CV<8%

  • Inter-Assay: CV<10%

Stability:
The loss rate of F2rl3 is less than 10% within the expiration date under appropriate storage conditions .

How does PAR4 signaling differ from other PARs in terms of receptor desensitization?

PAR4 exhibits a distinct signaling profile compared to other PARs, particularly regarding receptor desensitization:

Consequently, agonist-triggered phosphorylation and subsequent receptor internalization occur at a much slower rate for PAR4 compared to PAR1 or PAR2. This structural and functional distinction results in comparatively prolonged intracellular signaling downstream of PAR4 activation .

This extended signaling window may have significant implications for PAR4-mediated physiological and pathophysiological processes, making it an important consideration when designing experiments to study PAR4 function.

What is the role of PAR4 in nociception and pain signaling?

PAR4 plays a unique and somewhat paradoxical role in nociception and pain signaling. While PAR1 and PAR2 have been implicated in promoting nociceptive mechanisms, research has revealed that PAR4 may function differently:

  • Expression in sensory neurons: PAR4 is expressed in sensory neurons isolated from rat dorsal root ganglia (DRG) and colocalizes with key nociceptive peptides including calcitonin gene-related peptide (CGRP) and substance P .

  • Inhibitory effects on calcium signaling: PAR4-activating peptides (PAR4-AP) can inhibit calcium mobilization evoked by both KCl and capsaicin in rat sensory neurons, suggesting a modulatory role in neuronal excitability .

  • Anti-nociceptive effects: Intraplantar injection of PAR4-AP significantly increases nociceptive threshold in response to both thermal and mechanical noxious stimuli, while an inactive control peptide has no effect. These anti-nociceptive effects are dose-dependent and occur at doses below the threshold needed to cause inflammation .

  • Anti-inflammatory properties: Co-injection of PAR4-AP with carrageenan significantly reduces carrageenan-induced inflammatory hyperalgesia and allodynia, although it does not affect inflammatory parameters such as edema and granulocyte infiltration .

These findings suggest that PAR4 activation may represent a novel mechanism for modulating inflammatory pain and could be a potential target for analgesic drug development.

How can researchers design experiments to study PAR4-mediated calcium signaling in sensory neurons?

When designing experiments to study PAR4-mediated calcium signaling in sensory neurons, researchers should consider the following methodological approaches:

  • Preparation of primary sensory neuron cultures:

    • Isolate DRG neurons from rats (typically adult Sprague Dawley rats)

    • Enzymatically and mechanically dissociate the ganglia

    • Culture neurons in appropriate medium supplemented with nerve growth factor

    • Allow 24-48 hours for neurons to adhere and extend processes before experiments

  • Calcium imaging protocols:

    • Load cultured neurons with calcium-sensitive dyes (e.g., Fura-2 AM)

    • Record baseline calcium levels

    • Apply stimuli (KCl, capsaicin) to evoke calcium responses

    • Pre-treat or co-treat with PAR4-AP to assess modulatory effects

    • Include appropriate controls including PAR4 inactive peptides

  • Validation of PAR4 expression:

    • Confirm PAR4 expression in the cultured neurons using RT-PCR and immunocytochemistry

    • Examine colocalization with neuronal markers and nociceptive peptides (CGRP, substance P)

  • Pharmacological interventions:

    • Use selective PAR4 antagonists to confirm specificity of PAR4-AP effects

    • Apply signal transduction inhibitors to elucidate downstream pathways

  • Data analysis considerations:

    • Normalize calcium responses to baseline or maximum KCl response

    • Account for potential heterogeneity in neuronal populations

    • Apply appropriate statistical tests for repeated measures designs

What methodological approaches can be used to study the role of PAR4 in inflammatory processes?

To investigate PAR4's role in inflammatory processes, researchers can employ several methodological approaches:

  • In vitro inflammation models:

    • Cultures of immune cells (macrophages, neutrophils) treated with PAR4-AP

    • Co-cultures of immune cells with PAR4-expressing cells

    • Measurement of inflammatory mediator release (cytokines, chemokines)

    • Analysis of inflammatory signaling pathways (NF-κB, MAPK)

  • In vivo inflammation models:

    • Carrageenan-induced paw inflammation in rodents

    • Assessment of inflammatory parameters:

      • Edema (paw volume measurement)

      • Granulocyte infiltration (myeloperoxidase activity)

      • Hyperalgesia and allodynia (behavioral tests)

    • Intervention with PAR4-AP, administered either prophylactically or therapeutically

  • Genetic approaches:

    • PAR4 knockout mice or rats

    • Conditional knockout models to assess tissue-specific PAR4 functions

    • siRNA knockdown of PAR4 in cell cultures or in vivo

  • Pharmacological interventions:

    • Use of selective PAR4 agonists (PAR4-AP) and antagonists

    • Comparison with other PAR family members using selective activators/inhibitors

    • Evaluation of dose-dependent effects

  • Assessment of anti-inflammatory potential:

    • Determination of the optimal dosing that separates anti-nociceptive effects from inflammatory parameters

    • Investigation of mechanisms underlying the dissociation between pain modulation and classic inflammatory signs

What is known about the relationship between F2RL3 DNA methylation and disease risk?

Recent research has identified DNA methylation changes in F2RL3 in relation to disease risk, particularly lung cancer:

DNA methylation changes in peripheral blood have been identified in relation to lung cancer risk. Studies have shown that cg03636183, a CpG site located in the F2RL3 gene, demonstrates significant methylation changes associated with lung cancer .

In an Epigenome-Wide Association Study (EWAS) meta-analysis including 918 case-control pairs, F2RL3 methylation at cg03636183 showed significant associations with lung cancer risk (effect estimate: 0.636, standard error: 0.045, p-value: 7.99E-12) .

When stratified by smoking status, the associations were maintained across smoking categories:

  • Never smokers: effect estimate 0.909, standard error 0.172, p-value 5.53E-01

  • Former smokers: effect estimate 0.624, standard error 0.084, p-value 7.50E-05

  • Current smokers: effect estimate 0.786, standard error 0.069, p-value 2.92E-03

The consistency of effect across the studies was relatively high with an I² statistic of 71% and heterogeneity p-value of 0.03 .

What techniques are recommended for studying post-translational modifications of PAR4?

For studying post-translational modifications of PAR4, researchers should consider these methodological approaches:

  • Phosphorylation analysis:

    • Given PAR4's unique desensitization properties related to its lack of certain phosphorylation sites, phosphorylation studies are particularly relevant

    • Recommended techniques include:

      • Phospho-specific antibodies for Western blotting

      • Mass spectrometry-based phosphoproteomic analysis

      • In vitro kinase assays to identify relevant kinases

      • Site-directed mutagenesis of potential phosphorylation sites

  • Receptor internalization studies:

    • Fluorescently tagged PAR4 constructs for live cell imaging

    • Flow cytometry-based quantification of surface receptor expression

    • Biotinylation assays to track membrane vs. internalized receptor pools

    • Comparison with PAR1 and PAR2 internalization kinetics

  • Protein-protein interaction analysis:

    • Immunoprecipitation followed by mass spectrometry

    • Proximity ligation assays to visualize protein interactions in situ

    • FRET/BRET approaches for real-time interaction monitoring

    • Yeast two-hybrid screening to identify novel interacting partners

  • Receptor cleavage analysis:

    • N-terminal sequencing to confirm cleavage sites

    • Generation of cleavage-resistant mutants

    • Development of antibodies specific to the cleaved/uncleaved forms

    • Analysis of receptor activation in the presence of different proteases

These methodological approaches can provide valuable insights into the regulation of PAR4 function and may reveal novel therapeutic targets for conditions where PAR4 signaling plays a role.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.