Recombinant Rat Protrudin (Zfyve27)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance (additional fees apply).
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Zfyve27; Protrudin; Zinc finger FYVE domain-containing protein 27
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-404
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MQSSDRDLSGPEASPSVMPEVLSECSPAPTKSTAFDLFNLVLSYKRLEIYLEPLKDAGDG VRYLLRWQMPLCSLLTCLGLNILFLTLNEGAWYSVGALIISVPALLGYLQEVCRAQLPES ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLIRLEAFLARLCYTCESAYRVLHWENPV VSSQFYGALLGMVCMLYLLPLCWVLALLNSTLFLGNGEFFRVVSEYRACLQRRMSPKQEE CVCEGSALQDAGGRAVVLDSTPAPTPTEDLTPGSVEEAEEAEPDEEFKDAIEEDDEGTPC PAEDELTMQDNGFLSKNEVLRSKVSKLTERLRKRYPTNNFGNCAGCAATFSVLKKRRSCS NCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
Uniprot No.

Target Background

Function
Protrudin is a key regulator of RAB11-dependent vesicular trafficking during neurite extension, facilitating polarized membrane transport. It promotes axonal elongation and contributes to neuronal cell polarity establishment. It's involved in nerve growth factor-induced neurite formation via a VAPA-dependent mechanism. Protrudin contributes to both the formation and stabilization of the tubular endoplasmic reticulum (ER) network. Its role in ER morphogenesis involves regulating the sheet-to-tubule balance and potentially the density of tubule interconnections. Functioning as an adapter protein, it facilitates the interaction of KIF5A with VAPA, VAPB, SURF4, RAB11A, RAB11B, and RTN3. The ZFYVE27-KIF5A complex, facilitated by protrudin, contributes to the transport of these proteins in neurons. In non-neuronal cells, protrudin can induce the formation of neurite-like membrane protrusions in a KIF5A/B-dependent manner.
Gene References Into Functions
  1. Protrudin regulates Rab11-dependent membrane recycling to promote directional membrane trafficking essential for neurite formation. PMID: 17082457
Database Links
Subcellular Location
Recycling endosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, growth cone membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Protrudin?

Protrudin, also designated as ZFYVE27, is a 411 amino acid protein containing a single FYVE-type zinc finger domain. Its calculated molecular weight is 46 kDa, though the observed molecular weight in experimental conditions typically ranges between 46-50 kDa. The protein contains multiple functional domains that facilitate its interactions with cellular components, including transmembrane domains and binding sites for various trafficking-related proteins .

What are the key functional domains of Protrudin?

Protrudin contains several critical functional domains that mediate its cellular activities:

  • FYVE domain: Binds to phosphoinositides, enabling interaction with endosomes and the plasma membrane

  • Rab-binding domain (RBD): Required for Rab11 anterograde transport

  • Coiled-coil domain: Essential for interaction with the anterograde axonal motor KIF5

  • FFAT domain: Mediates interaction with VAP proteins at ER-membrane contact sites

  • Transmembrane domains (TM1-3): Anchor the protein to the endoplasmic reticulum

How does recombinant rat Protrudin differ from human Protrudin?

Rat Protrudin shares significant homology with human Protrudin, allowing for cross-species experimental applications. The protein maintains conserved functional domains across species, though researchers should note potential species-specific differences when designing experiments. Based on available research, rat Protrudin demonstrates similar localization patterns and interactions with trafficking machinery as observed in human cells .

What is the normal expression pattern of Protrudin in rat tissues?

Protrudin expression has been detected in multiple rat tissues, with particularly notable presence in neural tissues. Western blot analyses have confirmed detectable expression in rat brain tissue, thymus tissue, and testis tissue. Within the central nervous system, expression levels vary by developmental stage and neuronal subtype. Notably, Protrudin mRNA levels are relatively low in mature retinal ganglion cells compared to regenerative peripheral nervous system neurons .

How is Protrudin expression altered in pathological conditions?

Protrudin expression shows significant changes in pathological conditions, particularly in epilepsy models. In pentylenetetrazol (PTZ)-kindled mice, Protrudin protein levels were markedly reduced in both hippocampus (54.3% of control levels, p = 7.180×10^-9) and adjacent neocortex (64.5% of control levels, p = 3.131×10^-5). Similarly, in kainic acid (KA)-kindled mice, significant reductions were observed in the hippocampus (58.9% of control, p = 6.955×10^-6) and temporal cortex (77.3% of control, p = 0.017). These findings suggest Protrudin downregulation may be associated with epileptogenesis .

ModelBrain RegionProtrudin Level (% of Control)P-value
PTZ-kindledHippocampus54.3%7.180×10^-9
PTZ-kindledNeocortex64.5%3.131×10^-5
KA-kindledHippocampus58.9%6.955×10^-6
KA-kindledTemporal cortex77.3%0.017

How does Protrudin interact with the endoplasmic reticulum?

Protrudin localizes to the endoplasmic reticulum through two transmembrane domains and a hairpin loop. It interacts with VAP proteins at ER-membrane contact sites through its FFAT domain, which is crucial for its effects on cellular protrusion outgrowth. Beyond localization, Protrudin actively regulates ER distribution and network formation. Mutation studies of the FFAT or TM1-3 domains have demonstrated that these interactions are essential for Protrudin's role in axon regeneration, highlighting the importance of ER in this process .

What is the relationship between Protrudin and Rab11-mediated vesicular transport?

Protrudin functions as an upstream regulator of Rab11, significantly influencing directional protein transport. Research has demonstrated dynamic co-localization of Rab11 with Protrudin in axonal vesicles. The Rab-binding domain (RBD) of Protrudin is specifically required for Rab11 anterograde transport. Through this interaction, Protrudin facilitates the trafficking of recycling endosomes, which is particularly relevant to CNS axon repair as increased Rab11 transport into CNS axons enhances their regenerative capacity .

How does Protrudin modulate GABA receptor trafficking?

Coimmunoprecipitation analyses have revealed direct protein-protein interactions between Protrudin, GABA_A receptor β2/3 subunits, and GABARAP in the hippocampus of PTZ-induced epilepsy mice. These findings suggest that Protrudin may influence the transport of GABA_A receptors from intracellular stores to the cell membrane, potentially affecting inhibitory neurotransmission. This mechanism could explain the relationship between altered Protrudin expression and seizure activity observed in epilepsy models .

What are the optimal conditions for detecting recombinant rat Protrudin in Western blot experiments?

For optimal Western blot detection of recombinant rat Protrudin, the following technical parameters are recommended:

  • Dilution ratio: 1:500-1:1000

  • Expected molecular weight: 46-50 kDa

  • Sample preparation: Tissue homogenates from rat brain, thymus, or testis tissues provide reliable detection

  • Positive controls: Jurkat cells can serve as a positive control

  • Buffer conditions: PBS with 0.02% sodium azide and 50% glycerol at pH 7.3 provides optimal storage conditions for antibodies

  • Storage: Maintain antibodies at -20°C, where they remain stable for one year after shipment

What approaches can be used to manipulate Protrudin expression in neuronal cultures?

Multiple approaches have been validated for manipulating Protrudin expression in neuronal cultures:

  • Lentiviral overexpression: Lentiviral vectors expressing Protrudin have demonstrated successful transfection of hippocampal neurons, particularly in the CA3 region. This approach yields significant increases in Protrudin expression (approximately 2.2-2.3 fold compared to control) at both 14 and 45 days post-injection.

  • Domain-specific mutants: Researchers have successfully employed various domain-specific mutants to investigate the functional significance of different Protrudin domains:

    • RBD mutant: Deletion of the Rab-binding domain

    • Coiled-coil domain mutant: Affects interaction with KIF5

    • FYVE domain mutant: Prevents interaction with phosphoinositides on endosomal membranes

    • FFAT mutant: Disrupts interaction with VAP proteins

    • TM1-3 mutant: Affects ER localization

What imaging techniques are most effective for studying Protrudin localization in neurons?

Several imaging techniques have proven effective for studying Protrudin localization in neurons:

  • Immunofluorescence with neurofascin co-staining: This approach allows visualization of Protrudin distribution relative to the axon initial segment.

  • Quantitative immunofluorescence: This method enables measurement of relative fluorescence intensity across different cellular compartments and has been successfully used to determine axon-to-dendrite ratios.

  • Live cell imaging with fluorescently tagged constructs: mCherry-tagged wild-type or active Protrudin constructs allow visualization of dynamic localization.

  • Kymograph analysis: This technique has been employed to demonstrate dynamic co-localization of Protrudin with trafficking partners such as Rab11 and α9-integrin .

How can recombinant Protrudin be utilized for CNS axon regeneration studies?

Recombinant Protrudin has emerged as a powerful tool for CNS axon regeneration studies. Overexpression of either wild-type or active Protrudin in cortical neurons enhances axon regeneration in vitro. The mechanism appears to involve Protrudin's scaffold function, linking key regenerative players including axonal ER, recycling endosomes, and growth-promoting receptors. For in vivo applications, viral delivery (such as AAV2-ProtrudinGFP) to retinal ganglion cells has been successfully employed, with transduction efficiency reaching 40-45% of RGCs throughout the retina. Importantly, the protein distributes throughout uninjured axons following overexpression, making it suitable for pre-injury intervention studies .

What domain-specific Protrudin mutants provide the most insight into its regenerative functions?

Several domain-specific Protrudin mutants have provided critical insights into its regenerative functions:

  • FYVE domain mutant: The dominant negative FYVE domain mutant, which prevents interaction with phosphoinositides on endosomal membranes, significantly reduces Protrudin's regenerative effects.

  • Coiled-coil domain mutant: Mutation of this domain, which is essential for interaction with the anterograde axonal motor KIF5, impairs Protrudin-mediated axon regeneration.

  • FFAT domain mutant: This mutation disrupts Protrudin's interaction with VAP proteins at ER-membrane contact sites and abolishes its ability to promote ER localization to growth cones and axon tips.

  • TM1-3 domain mutant: Affecting ER localization, this mutation diminishes Protrudin's regenerative effects, highlighting the importance of ER in mediating CNS axon regeneration .

How does Protrudin expression correlate with seizure susceptibility and what implications does this have for epilepsy research?

Protrudin expression demonstrates a significant negative correlation with seizure activity. In multiple epilepsy models (PTZ-kindled and KA-kindled), Protrudin levels are markedly reduced in the hippocampus and cortex. Quantitative immunofluorescence analyses confirm weaker staining for Protrudin in the hippocampus of epileptic mice compared to controls. Interestingly, lentivirus-mediated overexpression of Protrudin in the hippocampus (particularly the CA3 region) results in significantly increased Protrudin expression (approximately 2.2-2.3 fold compared to control). This modulation of expression may offer a potential therapeutic approach for epilepsy research, particularly through Protrudin's interaction with GABA_A receptors and its potential role in inhibitory neurotransmission .

What controls should be included when assessing recombinant Protrudin function?

When assessing recombinant Protrudin function, researchers should include several controls:

  • Empty vector controls: For overexpression studies, appropriate empty vector controls (e.g., mCherry or GFP alone) should be employed.

  • Wild-type Protrudin: When studying active or mutant Protrudin forms, wild-type Protrudin should be included as a reference point.

  • Domain-specific mutants: Including specific domain mutants (FYVE, RBD, FFAT, etc.) can help dissect the contribution of individual domains to observed phenotypes.

  • Tissue-specific controls: For expression studies, multiple tissue samples should be examined given the differential expression across tissues (e.g., brain, thymus, testis for rat Protrudin) .

How can researchers verify successful transfection and expression of recombinant Protrudin?

Successful transfection and expression of recombinant Protrudin can be verified through multiple complementary approaches:

  • Fluorescent reporter detection: When using tagged constructs (e.g., GFP-Protrudin), direct visualization of fluorescence signal can confirm transfection. This has been successfully used to detect GFP autofluorescence after lentiviral injection in the hippocampus.

  • Western blot analysis: Quantitative assessment of protein levels can confirm overexpression. Studies have demonstrated significant increases in Protrudin levels following lentiviral transfection (2.2-2.3 fold increase compared to control).

  • Immunohistochemistry: Whole-mount retina staining or brain section immunohistochemistry can detect increased Protrudin levels following overexpression.

  • Functional assays: Changes in axon regeneration capacity or other functional readouts can indirectly confirm successful expression of active Protrudin .

What are the unexplored aspects of Protrudin function in neurological disorders?

While Protrudin has been studied in the context of axon regeneration and epilepsy, several aspects remain unexplored:

  • Role in other neurological disorders: The potential involvement of Protrudin in neurodegenerative diseases, stroke recovery, and traumatic brain injury remains largely uninvestigated.

  • Interaction with other neurotransmitter systems: While interaction with GABA receptors has been identified, Protrudin's potential interaction with other neurotransmitter systems requires further exploration.

  • Developmental regulation: The mechanisms governing the developmental regulation of Protrudin expression and localization in neurons are not fully understood.

  • Post-translational modifications: How Protrudin function is regulated by phosphorylation, ubiquitination, or other post-translational modifications remains to be comprehensively characterized .

How might Protrudin-based therapies be developed for CNS regeneration?

The development of Protrudin-based therapies for CNS regeneration could proceed along several promising avenues:

  • Viral vector delivery: AAV-mediated delivery of wild-type or active Protrudin has shown promise in preclinical models, with successful transduction of retinal ganglion cells and distribution throughout uninjured axons.

  • Domain-specific targeting: Rather than overexpressing the entire protein, therapeutic approaches might target specific interactions (such as enhancing ER-endosome contacts) based on domain function analysis.

  • Combinatorial approaches: Given Protrudin's scaffold function, combining Protrudin overexpression with other regeneration-promoting factors might yield synergistic effects.

  • Temporal manipulation: Controlling the timing of Protrudin upregulation relative to injury could optimize regenerative outcomes and minimize potential side effects .

What are the methodological challenges in studying the dynamic interactions of Protrudin with cellular components?

Several methodological challenges exist in studying Protrudin's dynamic interactions:

  • Visualizing ER-endosome contact sites: The transient nature of these contacts makes their visualization challenging, requiring advanced live-cell super-resolution microscopy.

  • Tracking multiple interaction partners simultaneously: As a scaffold protein, Protrudin interacts with multiple partners (VAP proteins, Rab11, KIF5, etc.), necessitating multi-color live imaging approaches.

  • Distinguishing direct versus indirect interactions: Determining whether observed effects are due to direct protein-protein interactions or secondary consequences requires careful biochemical validation.

  • Correlating in vitro findings with in vivo function: Translating mechanistic insights from cell culture to intact organisms remains challenging, particularly for complex processes like axon regeneration and seizure modulation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.