Recombinant Rat Putative gustatory receptor clone PTE01

Shipped with Ice Packs
In Stock

Description

Expression and Functional Context

While labeled as a gustatory receptor, Or7e24 belongs to the olfactory receptor family 7 subfamily E, suggesting potential cross-functional roles in chemosensation . In rodents:

  • Coexpression patterns of T1R/T2R taste receptors show segregated roles:

    • T1R1+T1R3: Umami/amino acid detection in fungiform taste buds .

    • T2Rs: Bitter compound recognition in circumvallate papillae .

  • Recombinant PTE01’s exact ligand specificity remains uncharacterized, though GPCR signaling mechanisms imply involvement in taste or olfactory transduction pathways .

3.1. Experimental Use Cases

  • Binding Studies: Utilized to investigate receptor-ligand interactions in vitro .

  • Localization: Membrane-associated expression confirmed via immunocytochemistry in heterologous systems .

3.2. Knowledge Gaps

  • No direct agonist/antagonist data available for PTE01 .

  • Limited evidence for endogenous expression in rat taste buds compared to well-studied T1R/T2R receptors .

Comparative Analysis with Orthologs

SpeciesReceptorFunctionExpression Site
RatPTE01/Or7e24Putative gustatory/olfactory receptorHeterologous systems
MouseTas2rBitter taste detectionCircumvallate papillae
HumanTAS1R3Sweet/umami perceptionTaste buds

Future Directions

Further studies should clarify PTE01’s role in vivo, including:

  • Transcriptomic profiling of Or7e24 in rat gustatory tissues.

  • Functional assays using native cells rather than recombinant systems.

  • Comparative studies with olfactory receptor homologs to resolve classification ambiguities .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery times may vary based on the purchase method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us beforehand, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Putative gustatory receptor clone PTE01; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Protein Sequence
MYLFLSNLSLADISFTSTTLPKMIVDIQTNNRAISYSGCLTQMSFFMLFGCLDSLLLTAM AYDRFVAICHPLHYQVIMNPRLCGLLVFLSILISLLVSQLHNSVVLQLTYFKSVDISHFF CDPSLLLNLACSDTFTNNIVMYFVGAISGFLPISGIFFSYYKIVSSILRMPSPGGKYKAF STCGS
Uniprot No.

Target Background

Function
Potential taste receptor.
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Tongue specific.

Q&A

What is Recombinant Rat Putative gustatory receptor clone PTE01?

Recombinant Rat Putative gustatory receptor clone PTE01 is a laboratory-produced protein that replicates the structure and function of a taste receptor naturally found in rats (Rattus norvegicus). It belongs to the gustatory receptor family, which are membrane proteins involved in taste perception. The full-length protein consists of 185 amino acids and is often produced with tags (such as His-tags) to facilitate purification and detection in experimental settings . The protein is expressed in various host systems, with E. coli being a documented expression system for the His-tagged version . As a putative gustatory receptor, PTE01 likely plays a role in detecting specific taste modalities, though its exact taste specificity remains under investigation.

How does PTE01 compare structurally to other gustatory receptor clones?

PTE01 shares structural similarities with other gustatory receptor clones, but also has distinct characteristics. When compared to another rat gustatory receptor clone, PTE38 (UniProt P35897), several differences become apparent:

FeaturePTE01PTE38
UniProt IDP35894P35897
Length185 amino acidsDifferent length (specific length not provided in search results)
Expression patternLikely expressed in specific taste cell subsetsMay have distinct expression pattern
Sequence homologyBaseline for comparisonPercentage similarity dependent on evolutionary relationship

Both receptors belong to the same family of gustatory receptors but may respond to different taste compounds . Researchers interested in comparative studies between these receptor clones should conduct sequence alignment analyses to identify conserved domains, which might indicate functional similarities, and divergent regions, which could suggest different ligand specificities or signaling properties.

What expression systems are optimal for producing Recombinant Rat Putative gustatory receptor clone PTE01?

The choice of expression system for PTE01 depends on research objectives, required protein yield, and downstream applications. Based on the available data and general practices for membrane proteins:

Expression SystemAdvantagesLimitationsRecommended for
E. coliCost-effective, high yield, rapid growthLimited post-translational modifications, inclusion body formation commonBasic binding studies, antibody production
Mammalian cells (HEK293, CHO)Native-like post-translational modifications, better folding of membrane proteinsHigher cost, lower yieldFunctional assays, signaling studies
Insect cells (Sf9, Sf21)Good for GPCRs, higher yield than mammalianDifferent glycosylation patternsStructural studies, ligand binding assays
Yeast (P. pastoris)High yield, some post-translational modificationsHyperglycosylationLarge-scale production

What are the optimal storage conditions for maintaining PTE01 stability?

Based on the information provided in the search results, the recommended storage conditions for maintaining PTE01 activity are:

Storage DurationRecommended ConditionNotes
Short-term (up to one week)4°CFor working aliquots
Medium-term-20°CStandard storage
Long-term-20°C to -80°CFor extended storage
Buffer compositionTris-based buffer with 50% glycerolOptimized for this protein
Additional recommendationsAvoid repeated freeze-thaw cyclesPrepare small working aliquots

The storage buffer containing 50% glycerol helps prevent protein denaturation during freezing by inhibiting ice crystal formation . The Tris buffer maintains optimal pH for protein stability. Researchers should note that repeated freezing and thawing is not recommended, as indicated in the product information, and working aliquots should be stored at 4°C for up to one week .

What purification methods are most effective for isolating His-tagged PTE01?

Effective purification of His-tagged Recombinant Rat Putative gustatory receptor clone PTE01 typically involves a multi-step approach:

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Use Ni-NTA or Co²⁺ matrices for initial capture

    • Apply imidazole gradient (20-300 mM) for selective elution

    • Include appropriate detergents to maintain solubility of this membrane protein

  • Size Exclusion Chromatography (SEC):

    • Separates properly folded protein from aggregates

    • Removes non-specific contaminants

    • Buffer typically contains 150-300 mM NaCl with appropriate detergent

  • Quality Control Assessments:

    • SDS-PAGE with Coomassie or silver staining

    • Western blot using anti-His antibodies

    • Activity assays at each purification stage

Based on the product information, commercially available PTE01 is supplied at 50 μg quantity, which suggests successful purification protocols have been established . For membrane proteins like gustatory receptors, maintaining the protein in a properly folded state during purification is critical, which may require specific detergents or lipid environments.

How can bioinformatic tools be used to analyze PTE01 structure-function relationships?

Bioinformatic analysis of PTE01 can provide crucial insights into its structure-function relationships. A comprehensive approach includes:

Sequence Analysis Tools:

  • BLAST and FASTA for identifying homologous proteins

  • Clustal Omega for multiple sequence alignments with other gustatory receptors

  • PSIPRED for secondary structure prediction

  • TMHMM or TOPCONS for transmembrane domain prediction

Structural Prediction and Analysis:

Tool CategoryExamplesApplication to PTE01
3D structure predictionAlphaFold, RoseTTAFoldGenerate structural models of PTE01
Molecular visualizationPyMOL, ChimeraVisualize predicted structures, design mutations
Binding site predictionCASTp, COACHIdentify potential taste ligand binding pockets
Conservation analysisConSurfIdentify evolutionarily conserved functional residues

Functional Prediction Workflow:

  • Begin with sequence analysis to identify conserved motifs shared with other gustatory receptors

  • Predict membrane topology and transmembrane domains

  • Generate 3D structural models and identify potential binding sites

  • Compare with related gustatory receptors to infer taste modality

  • Design in silico mutations to test hypotheses about structure-function relationships

These computational approaches generate testable hypotheses that can guide experimental design for further investigation of PTE01 function and specificity.

What methods can be used to study PTE01 activation by potential taste ligands?

Studying PTE01 activation by potential taste ligands requires specialized assays that can detect receptor response. The following methodologies are recommended:

Functional Assays:

Assay TypeMethodologyAdvantagesLimitations
Calcium imagingMeasure Ca²⁺ flux using fluorescent indicatorsReal-time readout, cellular contextIndirect measure of activation
BRET/FRET assaysMonitor conformational changes upon ligand bindingDirect measure of receptor engagementComplex setup, requires protein engineering
GTPγS bindingMeasure G-protein activationDirectly assesses functional couplingRequires purified components
ElectrophysiologyRecord membrane currents in expressing cellsHigh temporal resolutionLow throughput, technically demanding

Experimental Considerations:

  • Test a range of potential taste ligands at physiologically relevant concentrations

  • Include positive controls (known taste receptor agonists) and negative controls

  • Validate results across multiple assay platforms

  • Consider potential species-specific differences in ligand preference

Analysis should include dose-response curves to determine EC₅₀ values, Hill coefficients to assess cooperativity, and comparison across multiple ligands to establish selectivity profiles. These approaches will help characterize the functional properties of PTE01 and potentially identify its natural ligands.

How can CRISPR-Cas9 be used to study PTE01 function in vivo?

CRISPR-Cas9 technology provides powerful approaches for studying PTE01 function through precise genetic modifications:

Gene Editing Strategies:

  • Complete knockout to eliminate PTE01 expression

  • Knock-in of reporter genes (e.g., GFP) to visualize expressing cells

  • Introduction of point mutations to study specific functional residues

  • Conditional knockout using Cre-loxP systems

  • Replacement of rat sequence with human orthologs for comparative studies

Implementation Approaches:

CRISPR ApplicationMethodologyResearch Outcome
Germline editingEmbryo injection of CRISPR componentsStable transgenic rat lines with PTE01 modifications
Somatic editingViral delivery to taste tissuesTissue-specific modifications in adult animals
Base editingTargeted nucleotide changesPrecise point mutations in PTE01 sequence
CRISPR activation/inhibitiondCas9 fused to activators/repressorsModulation of PTE01 expression levels

Functional Analysis Pipeline:

  • Molecular verification (genotyping, sequencing, RT-PCR)

  • Protein expression analysis (immunohistochemistry, Western blot)

  • Cellular physiology (calcium imaging, electrophysiology of taste cells)

  • Behavioral testing (taste preference, discrimination tests)

CRISPR-Cas9 approaches allow for unprecedented precision in understanding PTE01 function in its native physiological context, connecting molecular mechanisms to organismal behavior.

How can PTE01 be used in comparative studies with human gustatory receptors?

PTE01 can serve as a valuable model for comparative studies with human gustatory receptors, providing insights into evolution, function, and specificity:

Comparative Approaches:

  • Sequence alignment between PTE01 and human gustatory receptor orthologs

  • Phylogenetic analysis to trace evolutionary relationships

  • Structural modeling to identify conserved and divergent features

  • Functional comparison through heterologous expression systems

Experimental Strategies:

ApproachMethodologyInsight Gained
Heterologous expressionExpress both rat and human receptors in same systemDirect comparison of pharmacological properties
Chimeric receptorsSwap domains between rat and human receptorsIdentify species-specific functional regions
Cross-species ligand panelsTest same compounds on both receptorsReveal evolutionary shifts in specificity
Reporter assaysUse identical reporters for both receptorsCompare signaling efficiency

Translational Applications:

  • Use PTE01 as a screening platform for compounds targeting human receptors

  • Identify conserved mechanisms that inform human taste perception

  • Understand species-specific taste preferences and aversions

  • Develop models for taste modulator discovery

These comparative approaches bridge the gap between rodent models and human applications, providing valuable insights for both basic taste biology and potential applications in food science and drug development.

What mutation strategies can be used to study structure-function relationships in PTE01?

Creating mutant versions of PTE01 enables systematic investigation of structure-function relationships through various strategic approaches:

Mutation Design Strategies:

  • Alanine scanning: Systematically replace individual residues with alanine

  • Conservative substitutions: Replace residues with similar ones to probe specific properties

  • Domain swapping: Exchange regions between PTE01 and other gustatory receptors

  • Truncations: Remove portions to determine minimal functional units

Targeted Mutation Approaches:

Target RegionRationaleExpected Outcome Analysis
Extracellular loopsLikely involved in ligand bindingAltered ligand affinity or specificity
Transmembrane domainsCritical for signal transductionChanged activation properties
Intracellular loopsInteract with signaling machineryModified downstream signaling
N/C terminiMay affect traffickingAltered surface expression

Implementation Methods:

  • Site-directed mutagenesis using PCR-based approaches

  • Gibson Assembly for larger modifications or domain swaps

  • Golden Gate cloning for creating libraries of variants

Functional Assessment Pipeline:

  • Expression analysis (Western blot, flow cytometry)

  • Subcellular localization (microscopy)

  • Ligand binding assays (comparing wild-type and mutant affinities)

  • Signaling assays (calcium imaging, cAMP measurements)

When designing mutation studies, it's valuable to guide efforts using structural predictions, evolutionary conservation analysis, and comparison with related receptors where function is better characterized.

What statistical approaches are most appropriate for analyzing taste receptor activation data?

Analyzing PTE01 activation data requires appropriate statistical methods tailored to the experimental design:

Dose-Response Analysis:

  • Nonlinear regression to fit dose-response curves (typically sigmoidal)

  • Comparison of EC₅₀ values using extra sum-of-squares F test

  • Confidence interval determination for potency estimates

  • Hill slope analysis to evaluate cooperativity

Comparison Between Conditions:

Experimental DesignRecommended TestAssumptionsAlternative Tests
Two independent groupsStudent's t-testNormal distribution, equal varianceMann-Whitney U test
Multiple independent groupsOne-way ANOVA with post-hoc testsNormal distribution, equal varianceKruskal-Wallis test
Repeated measuresRepeated measures ANOVASphericityMixed-effects models
Concentration seriesTwo-way ANOVANormality, equal varianceNon-parametric factorial analysis

Practical Implementation:

  • Determine appropriate sample size through power analysis

  • Include positive and negative controls in experimental design

  • Apply multiple comparison corrections (e.g., Bonferroni, Holm-Sidak)

  • Report effect sizes along with p-values

  • Visualize data with appropriate plots (box plots, violin plots)

How should I interpret discrepancies in PTE01 binding data across different experimental conditions?

Interpreting discrepancies in PTE01 binding data requires systematic evaluation of experimental variables:

Common Sources of Discrepancies:

FactorPotential ImpactMitigation Strategy
Expression systemDifferent post-translational modificationsCompare results across systems
Membrane compositionAltered receptor conformationStandardize lipid environment
Buffer conditionsChanges in protein stabilityTest pH, salt, and ion dependence
TemperatureAltered binding kineticsControl temperature strictly
Tag position/typeSteric hindrance of bindingCompare N- vs C-terminal tags
Receptor densityDimerization effectsTitrate expression levels

Analytical Approaches:

  • Perform Bland-Altman analysis to systematically compare methods

  • Use Scatchard or Hill plots to identify binding cooperativity differences

  • Apply global fitting of datasets to extract consistent parameters

  • Conduct Z' factor analysis to assess assay quality

Interpretation Framework:

  • First establish reproducibility within a single experimental setup

  • Systematically vary one condition at a time to identify sensitive parameters

  • Consider physiological relevance when weighing conflicting results

  • Triangulate with multiple methodologies for consensus values

When reporting discrepancies, clearly document all experimental conditions and propose biological or methodological explanations for observed differences, rather than simply selecting preferred data points.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.