Recombinant Rat Putative gustatory receptor clone PTE03 (Olr1145)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag type, please inform us, and we will prioritize its implementation.
Synonyms
Olr1145; Putative gustatory receptor clone PTE03; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Olr1145
Target Protein Sequence
TTVPKMLINLQKQNKAISYAGCITQLSFVLLFAGMENFLLAAMAYDRYVAICKPLRYTAI MKAHLCLVMTLLSLCISIVDALLHGLMILRLSFCTFLEIPHYFCELYQVIKLSCSDTLIN NILVYTMTSTLGGVPLGGIIFSYFKIISSILRMPSSGSRHRAFSTCGS
Uniprot No.

Target Background

Function
Putative gustatory receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Tongue specific.

Q&A

What structural family does Olr1145 belong to and what are its predicted domains?

Olr1145 (Putative gustatory receptor clone PTE03) belongs to the G-protein coupled receptor 1 family . As a member of this superfamily, it likely contains the characteristic seven-transmembrane domain architecture typical of GPCRs. The protein structure would include three extracellular loops, three intracellular loops, an extracellular N-terminus, and an intracellular C-terminus. The transmembrane domains are likely composed of hydrophobic α-helices that span the cell membrane, with the ligand-binding pocket typically formed by the extracellular domains and upper portions of the transmembrane helices .

How should researchers optimize storage conditions for recombinant Olr1145 protein?

Based on empirical evidence with recombinant Olr1145, the following storage protocol is recommended:

  • Upon receipt, briefly centrifuge the vial to ensure contents are at the bottom

  • For long-term storage, store the lyophilized powder at -20°C or preferably -80°C

  • After reconstitution, add glycerol to a final concentration of 50% for freezing stability

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

Research indicates that properly stored recombinant protein maintains activity for approximately 12 months in lyophilized form at -20°C/-80°C, while liquid preparations have a reduced shelf life of approximately 6 months under optimal storage conditions .

What expression systems have been validated for recombinant Olr1145 production?

The most commonly validated expression system for Olr1145 is Escherichia coli (E. coli) . This prokaryotic system offers several advantages for Olr1145 expression:

  • High yield production of the relatively small (168 aa) protein

  • Compatibility with N-terminal His-tagging for simplified purification

  • Cost-effective scale-up compared to eukaryotic systems

  • Successful expression of the full-length protein despite the transmembrane domains

For researchers requiring post-translational modifications, alternative expression systems may be considered, though these are less well-documented for Olr1145 specifically. The standard E. coli expression system has been shown to produce protein with greater than 90% purity as determined by SDS-PAGE analysis .

What reconstitution protocols yield optimal Olr1145 solubility and stability?

Based on experimental data, the following reconstitution protocol is recommended for maximal stability and solubility of recombinant Olr1145:

  • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 50%

  • The recommended storage buffer composition is Tris/PBS-based buffer containing 6% Trehalose at pH 8.0

This protocol has been validated to maintain protein stability while minimizing aggregation. The addition of 6% trehalose serves as a cryoprotectant and stabilizing agent for the protein structure during freeze-thaw cycles .

What purification strategies yield the highest purity for recombinant Olr1145?

The standard purification workflow for His-tagged recombinant Olr1145 consists of:

  • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin as the primary capture step

  • Optional: Size exclusion chromatography for removal of aggregates and dimers

  • Buffer exchange to remove imidazole and other purification additives

  • Concentration determination via UV spectroscopy (A280) or Bradford assay

  • Quality control via SDS-PAGE analysis to confirm >90% purity

This approach typically yields protein with greater than 90% purity as assessed by SDS-PAGE, suitable for most research applications including functional assays and antibody production .

What experimental approaches can elucidate Olr1145 ligand interactions?

Based on studies of related gustatory receptors, several approaches can be applied to investigate Olr1145 ligand interactions:

  • Calcium imaging assays: Monitoring changes in intracellular calcium levels in response to potential ligands using calcium indicators such as GCaMP6m. This approach has been successfully used for other gustatory receptors, as demonstrated in the Gr28b.c GRNs study .

  • Whole-animal imaging preparation: Developing an imaging chamber to minimize head movements, similar to the method used for larval Drosophila, could be adapted for investigating Olr1145 responses in rat models .

  • Electrophysiological recordings: Patch-clamp techniques can measure receptor-mediated currents in response to potential ligands. This is particularly valuable for understanding channel kinetics and receptor desensitization.

  • Fluorescence resonance energy transfer (FRET): This technique can be used to study conformational changes in the receptor upon ligand binding.

The most promising initial approach would be calcium imaging in heterologous expression systems, as this provides a robust readout of receptor activation while requiring relatively accessible equipment .

How does the amino acid sequence of Olr1145 inform structure-function relationships?

Analysis of the Olr1145 amino acid sequence reveals key structural elements that likely contribute to its function as a gustatory receptor:

  • The presence of multiple hydrophobic regions consistent with transmembrane domains characteristic of G-protein coupled receptors

  • Conserved motifs shared with other members of the gustatory receptor family

  • Putative ligand-binding domains based on sequence homology with related receptors

Detailed structure-function studies, similar to those conducted on Drosophila gustatory receptors, would be required to definitively identify the critical residues for Olr1145 function. For instance, research on Drosophila Gr28b.a and Gr28b.c identified seven identical residues in their N-terminal halves that may be important for ligand recognition . Similar approaches could be applied to Olr1145 through site-directed mutagenesis of conserved residues followed by functional assays.

What model systems are most appropriate for studying Olr1145 in vivo function?

Based on available research methodologies:

  • Native rat models: As Olr1145 is a rat gustatory receptor, studies in its native context would provide the most physiologically relevant data. Techniques such as in situ hybridization could be used to localize receptor expression, similar to methods used for rIL-3R beta mRNA visualization .

  • Heterologous expression systems: Cell lines such as HEK293 can be transfected with Olr1145 for controlled studies of receptor function in isolation from other taste receptors.

  • Ex vivo tissue preparations: Isolated taste buds or lingual epithelial preparations containing gustatory receptors can be used for more physiologically relevant studies while maintaining experimental control.

For initial characterization, a combination of heterologous expression for biochemical studies and native tissue for physiological relevance would provide complementary insights into Olr1145 function.

How does Olr1145 compare structurally to other gustatory receptors?

Comparison of Olr1145 with other gustatory receptors reveals both conservation and divergence:

FeatureOlr1145 (Rat)Gr28 Family (Drosophila)Implications
Protein Length168 amino acidsVaries (e.g., Gr28b.c)Olr1145 is relatively compact
Receptor FamilyG-protein coupled receptor 1 familyInsect gustatory receptor familyPotential functional convergence despite divergent evolution
Membrane TopologyPredicted 7 transmembrane domainsAtypical topology compared to conventional GPCRsDifferent structural organization may support similar functions
Ligand Binding DomainNot fully characterizedIdentified in Gr28b.a/Gr28b.cPotential for similar ligand recognition mechanisms

While mammalian taste receptors and insect gustatory receptors have diverged significantly during evolution, they may employ similar mechanisms for taste perception. Studies of Drosophila Gr28 receptors have shown that different members of the same receptor family can have distinct or even opposing functions (attraction vs. repulsion) , suggesting that close structural homology does not necessarily predict functional similarity.

What insights from Drosophila gustatory receptor research can be applied to Olr1145 studies?

Research on Drosophila gustatory receptors provides valuable methodological approaches that can be adapted for Olr1145 studies:

  • Functional redundancy analysis: Studies in Drosophila identified redundant roles for Gr28b.a and Gr28b.c in denatonium detection . Similar redundancy might exist between Olr1145 and related rat gustatory receptors.

  • Co-expression analysis: The identification of co-expressed receptor subunits in Drosophila (e.g., Gr28b genes with Gr66a) suggests that mapping the co-expression patterns of Olr1145 with other taste receptors could reveal functional receptor complexes .

  • Calcium imaging protocols: The whole-animal calcium imaging techniques developed for Drosophila larvae could be adapted for studying Olr1145 in appropriate model systems .

  • Receptor subunit rescue experiments: The approach of expressing individual receptor subunits in mutant backgrounds to identify essential components could be applied to Olr1145 studies .

These methodological approaches could significantly advance our understanding of Olr1145 function in rat gustatory perception.

How can site-directed mutagenesis be applied to identify critical functional residues in Olr1145?

A systematic site-directed mutagenesis approach for Olr1145 functional characterization would include:

  • Identification of conserved residues: Compare Olr1145 sequence with other gustatory receptors to identify highly conserved amino acids likely critical for function.

  • Transmembrane domain mutations: Systematically mutate residues in predicted transmembrane domains that may participate in ligand binding or receptor activation.

  • Extracellular loop mutations: Focus on residues in extracellular loops that potentially form the ligand-binding pocket.

  • Functional screening: Express mutant receptors in heterologous systems and screen for altered responses to potential ligands using calcium imaging or electrophysiology.

This approach has proven successful for other gustatory receptors. For instance, research on Drosophila gustatory receptors identified seven identical residues between Gr28b.a and Gr28b.c that may be critical for denatonium recognition .

What approaches can resolve the three-dimensional structure of Olr1145?

Determining the three-dimensional structure of membrane proteins like Olr1145 presents significant challenges. Multiple complementary approaches would be required:

  • X-ray crystallography: Requires production of highly purified, stable, and homogeneous protein samples, often facilitated by:

    • Creation of thermostabilized variants through systematic mutagenesis

    • Use of fusion partners to enhance crystallization

    • Incorporation of antibody fragments or nanobodies to stabilize specific conformations

  • Cryo-electron microscopy (cryo-EM): Increasingly powerful for membrane protein structures, requiring:

    • Optimization of detergent or nanodisc reconstitution

    • Sample vitrification optimization

    • High-resolution data collection and processing

  • NMR spectroscopy: Most suitable for smaller domains rather than the full-length receptor:

    • Expression of isotopically labeled protein fragments

    • Solution or solid-state NMR approaches depending on domain size

  • Computational modeling: When experimental structures remain elusive:

    • Homology modeling based on related receptors

    • Molecular dynamics simulations to predict conformational changes

    • Integration with experimental constraints from mutagenesis or spectroscopic studies

Given current technological limitations, a hybrid approach combining computational modeling with experimental validation through mutagenesis would likely be most productive for Olr1145 structural studies.

How can transcriptomic approaches advance our understanding of Olr1145 expression patterns?

Advanced transcriptomic approaches to characterize Olr1145 expression include:

  • Single-cell RNA sequencing (scRNA-seq): This technique can:

    • Identify specific cell types expressing Olr1145 in taste buds

    • Reveal co-expression patterns with other taste receptors

    • Discover novel cell populations involved in taste sensation

  • Spatial transcriptomics: Methods such as in situ sequencing or Slide-seq can:

    • Map Olr1145 expression within the three-dimensional architecture of taste buds

    • Correlate receptor expression with anatomical structures

    • Provide insights into functional organization of taste perception

  • Developmental transcriptomics: Time-course analysis of Olr1145 expression during development can:

    • Reveal temporal patterns of receptor expression

    • Identify regulatory factors controlling Olr1145 expression

    • Provide insights into taste system maturation

These approaches would significantly advance our understanding of Olr1145's role in the complex gustatory system of rats and potentially inform comparative studies with human taste perception.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.