Recombinant Rat Pyroglutamylated RFamide peptide receptor (Qrfpr)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Pyroglutamylated RFamide Peptide Receptor (Qrfpr)

The Recombinant Rat Pyroglutamylated RFamide peptide receptor (Qrfpr) is a G-protein-coupled receptor (GPCR) that plays a crucial role in various physiological processes. It is part of the RFamide peptide receptor family, which includes several subtypes involved in neuroendocrine, behavioral, and sensory functions . The Qrfpr specifically interacts with pyroglutamylated RFamide peptides, such as QRFP (also known as 26RFa or 43RFa), which are involved in energy homeostasis, aldosterone secretion, and other biological processes .

Structure and Function

  • Structure: The Qrfpr is a transmembrane receptor with seven transmembrane domains, similar to other GPCRs . It activates the Gq and Gi/o signaling pathways upon binding to its ligands .

  • Function: This receptor is implicated in regulating energy balance, modulating food intake, and influencing insulin sensitivity . Additionally, it affects aldosterone secretion and bone formation .

Biological Significance

The Qrfpr system is significant in understanding metabolic disorders and other physiological conditions. It has been implicated in obesity and diabetes due to its role in energy homeostasis . The receptor's interaction with QRFP peptides suggests a potential therapeutic target for treating metabolic imbalances .

Research Findings

Recent studies have highlighted the complexity of the RFamide peptide system, including the Qrfpr. The structural basis for the recognition of 26RFa by Qrfpr has been elucidated, providing insights into the design of selective agonists and antagonists for therapeutic applications .

Table 1: Key Features of Qrfpr

FeatureDescription
Protein NamePyroglutamylated RFamide peptide receptor
Gene NameQRFPR
OrganismRattus norvegicus (Rat)
Transmembrane Domains7
Length (aa)Approximately 431 amino acids (similar to human QRFPR)
Signaling PathwaysGq and Gi/o
LigandsQRFP (26RFa, 43RFa), P518

Evolutionary Aspects

In vertebrates, the QRFPR gene has undergone significant evolutionary changes. While mammals and birds have a single QRFPR gene, some fish and reptiles possess multiple QRFPR genes due to early vertebrate tetraploidizations . This diversity suggests that the QRFPR system has evolved to fulfill different physiological roles across species.

Therapeutic Potential

Given its involvement in energy homeostasis and metabolic regulation, the Qrfpr is a promising target for developing treatments for obesity, diabetes, and other metabolic disorders . Selective agonists and antagonists of Qrfpr could modulate food intake and insulin sensitivity, offering potential therapeutic strategies .

Product Specs

Form
Lyophilized powder
Note: While we will preferentially ship the format we have in stock, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please contact your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents are at the bottom. Reconstitute the protein in sterile deionized water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it based on your request.
Synonyms
Qrfpr; Gpr103; Pyroglutamylated RF-amide peptide receptor; AQ27; G-protein coupled receptor 103; Orexigenic neuropeptide QRFP receptor; SP9155
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-433
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MQALNITAEQFSRLLSAHNLTREQFIHRYGLRPLVYTPELPARAKVAFALAGALIFALAL FGNSLVIYVVTRSKAMRTVTNIFICSLALSDLLIAFFCIPVTMLQNISDKWLGGAFICKM VPFVQSTAVVTEILTMTCIAVERHQGLVHPFKMKWQYTTRRAFTILGVVWLAAIIVGSPM WHVQRLEIKYDFLYEKEHICCLEEWASPVHQRIYSTFILVILFLLPLVVMLVLYSKIGYE LWIKKRVGDSSALQTIHGKEMSKIARKKKRAVIMMVTVVALFAACWAPFHVVHMMVEYSN FEKEYDDVTIKMVFAVAQTIGFFNSICNPFVYAFMNENFKKNFLSAVCYCIVKESSSPAR KPGNSGISMMQKRAKLSRPQRPVEETKGDTFSDASIDVKLCEQPREKRQLKRQLAFFSSE LSENSTFGSGHEL
Uniprot No.

Target Background

Function
The Pyroglutamylated RFamide peptide receptor (Qrfpr) is a receptor for the orexigenic neuropeptide QRFP. This receptor's activity is mediated by G proteins, which modulate adenylate cyclase activity and intracellular calcium levels.
Gene References Into Functions
  1. prepro-QRFP mRNA and GPR103a mRNA are expressed in L6 cells, although GPR103b mRNA was not detected. Using complementary assays, co-incubation with QRFP-26 enhanced insulin's ability to induce glycogen synthesis and 2-deoxyglucose uptake in L6 cells. PMID: 25895849
  2. We identified an additional receptor with high homology to GPR103 in rats. This receptor increases inositol triphosphate production in transfected cells in the presence of QRFP(26). Its mRNA was particularly enriched in the brain (GPR103 protein, rat). PMID: 16996040
  3. QRFP mRNA was highly expressed in the hypothalamus, while QRFP receptor mRNA was highly expressed in the adrenal gland. These findings suggest that QRFP and its receptor play a regulatory role in the rat adrenal gland. PMID: 12960173
  4. QRFP and GPR103A/B may regulate various neuroendocrine and behavioral functions, potentially implicating this neuropeptide system in metabolic syndrome. PMID: 16648250
  5. The expression of GPR103 mRNA was more localized, notably in the midbrain, pons, and medulla oblongata. PMID: 17534937

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in the adrenal gland and at moderate levels in the eye and testis. Expressed widely in the brain with high levels in the hypothalamus and moderate levels in the amygdala, basal forebrain, cortex, medulla oblongata, midbrain and thalamus.

Q&A

What is the molecular identity of rat Qrfpr?

Rat pyroglutamylated RFamide peptide receptor (Qrfpr) is a class A G-protein-coupled receptor (GPCR) encoded by the Qrfpr gene (Gene ID: 310327). This receptor, also known as GPR103 or orexigenic neuropeptide QRFP receptor, is selectively activated by QRFP peptides that possess the characteristic C-terminal RF-amide motif. In humans, QRFPR is a 431 amino acid protein containing 7 transmembrane domains, with a similar structure conserved across species including rat . The receptor was initially identified as an orphan GPCR from human brain cDNA libraries, before its endogenous ligands were discovered .

What are the primary endogenous ligands for rat Qrfpr?

The primary endogenous ligands for rat Qrfpr are QRFP peptides, particularly the 26-amino acid form (QRFP26 or 26RFa) and the longer 43-amino acid peptide. These peptides feature the characteristic C-terminal RF-amide motif that is critical for receptor recognition and activation. QRFP26 has been identified as a high-affinity ligand for QRFPR, with the 43-amino acid version appearing necessary for full agonistic activity . Recent structural studies have revealed that QRFP26 adopts an extended conformation when bound to the receptor, with no secondary structure elements, allowing its N-terminal and C-terminal regions to interact with distinct domains of the receptor .

What is the tissue distribution pattern of Qrfpr in rats?

In rats and other mammals, Qrfpr shows a distinct expression pattern with predominant expression in:

  • Brain (highest expression)

  • Heart

  • Kidney

  • Retina

  • Testis

This distribution pattern suggests diverse physiological roles beyond central nervous system functions. The receptor and its ligand precursor mRNA exhibit particularly high expression in brain tissues, indicating important neurological functions .

What is the structural basis for QRFP recognition by Qrfpr?

Recent cryo-electron microscopy studies have revealed the precise structural basis for QRFP recognition by its receptor. The QRFP26-QRFPR-Gq complex structure at 3.19 Å resolution shows that QRFP26 adopts an extended conformation without secondary structure when bound to the receptor . The binding mechanism involves:

  • The N-terminal portion of QRFP26 is recognized by the extracellular domain of QRFPR

  • The C-terminal portion interacts with the transmembrane domain of the receptor

  • The peptide adopts a unique binding mode where Gly3-Tyr15 in 26RFa forms an α-helix, while the C-terminus displays as an extended loop

  • The C-terminal heptapeptide of 26RFa resides within the transmembrane binding pocket

This binding mechanism is critical for high-affinity interaction and receptor specificity .

How does the extracellular region of Qrfpr contribute to ligand binding?

The extracellular region of Qrfpr plays a crucial role in ligand recognition and binding:

  • The N-terminus of QRFPR (E9-G42) forms a unique assembly with the peptide's N-terminus and the receptor's ECL2 (extracellular loop 2)

  • This assembly is distinctive compared to other class A GPCRs, where the N-terminus is often short or lacks visible structural density

  • Mutagenesis experiments have demonstrated that disrupting key residues at the N-terminus-ECL2-26RFa interface significantly reduces peptide activity

  • This unique assembly mode contributes to the high specificity of the receptor-ligand interaction

What are the key differences in binding mechanisms between QRFPR and other RF-amide peptide receptors?

Structural comparisons with closely related receptors have revealed both conserved and diversified peptide recognition mechanisms:

  • Unlike some related receptors, QRFP26 adopts an extended structure rather than a helical conformation when bound to QRFPR

  • The RF-amide moiety of QRFP shows similarities in binding to the transmembrane domain compared to other RF-amide peptides

  • The phenyl group of phenylalanine in the RF-amide moiety inserts into the helical core of the receptor, making direct contact with W286^6.48, a conserved toggle switch residue in class A GPCRs responsible for peptide-induced receptor activation

  • This binding pattern shares similarities with the RY-amide segment in neuropeptide Y, though with distinct receptor-specific interactions

What structural methods have proven most effective for studying Qrfpr?

Several structural methods have been successfully employed to study Qrfpr, with cryo-electron microscopy (cryo-EM) emerging as particularly effective:

  • Cryo-EM has been used to determine the structure of the QRFP26-QRFPR-Gq complex at high resolution (3.19 Å)

  • To facilitate the expression of the QRFPR-Gq complex, researchers have introduced a cytochrome b562RIL (BRIL) at the N-terminus of the full-length wild-type human QRFPR

  • A Gαq chimera (GαsqiN) engineered based on the mini-Gαs scaffold has been successfully used in structure determination of QRFPR-Gq complexes

  • The NanoBiT tethering strategy has been employed to stabilize the QRFPR-Gq complex

  • Efficient assembly of the 26RFa-QRFPR-Gq-scFv16 complex was achieved by incubating 26RFa with membranes from cells co-expressing the receptors, Gq heterotrimers, and scFv16

What mutagenesis approaches have been effective in analyzing QRFPR function?

Mutagenesis experiments have been crucial in validating the functional importance of specific residues in QRFPR:

  • Site-directed mutagenesis targeting residues at the N-terminus-ECL2-26RFa interface has demonstrated their importance for peptide activity

  • Mutations affecting the assembly between the receptor's extracellular region and the peptide significantly impact the regulation of QRFPR activity by 26RFa

  • Specific mutations like those affecting L193 at the N-terminus-ECL2-26RFa interface caused remarkable declines in peptide activity

What expression systems are optimal for producing functional recombinant rat Qrfpr?

Based on successful structural and functional studies, certain expression systems have proven effective for recombinant QRFPR production:

  • Mammalian expression systems have been used for co-expression of QRFPR with G proteins for structural studies

  • Cell membrane preparations from these expression systems have been successfully used for complex formation with ligands and G proteins

  • For structural studies, modifications such as fusion with cytochrome b562RIL (BRIL) at the N-terminus of the full-length receptor have facilitated expression and analysis

What are the primary physiological roles of QRFPR in rats?

QRFPR mediates several important physiological functions in rats and other mammals:

  • Energy metabolism regulation

  • Appetite control and feeding behavior

  • Potential roles in adipogenesis regulation through autocrine/paracrine mechanisms

  • Adrenal gland function, as evidenced by QRFP administration causing aldosterone release

How does QRFPR signaling differ from other related neuropeptide receptors?

QRFPR exhibits unique signaling characteristics compared to other RF-amide peptide receptors:

  • QRFPR selectively couples to the Gq protein pathway, as evidenced by structural studies of the QRFP26-QRFPR-Gq complex

  • The activation mechanism involves structural changes in the transmembrane domain, with TM7 showing a slightly inward shift toward the core of the helical bundle upon activation

  • The activation mechanism appears to involve conserved "micro-switch" motifs including P5.50T3.40F6.44 and N7.49P7.50xxY7.53

  • Though part of the RF-amide family of receptors, QRFPR shows distinct ligand specificity and cellular distribution compared to related receptors like neuropeptide FF (NPFF), prolactin-releasing peptide (PrRP), kisspeptin (Kiss1), and gonadotropin-inhibitory hormone (GnIH) receptors

How conserved is QRFPR across different species?

QRFPR shows significant conservation across mammalian species, with orthologs identified in:

SpeciesGene IDProtein Name
Human84109pyroglutamylated RFamide peptide receptor
Mouse229214pyroglutamylated RFamide peptide receptor
Rat310327pyroglutamylated RFamide peptide receptor
Cow529752pyroglutamylated RFamide peptide receptor
Horse100072268pyroglutamylated RFamide peptide receptor
Naked mole-rat101716072pyroglutamylated RFamide peptide receptor
Domestic guinea pig100732324pyroglutamylated RFamide peptide receptor
Domestic cat101091105pyroglutamylated RFamide peptide receptor
Dog483846pyroglutamylated RFamide peptide receptor
Chicken422671pyroglutamylated RFamide peptide receptor
Domestic Rabbit100355392pyroglutamylated RFamide peptide receptor
Sheep100145863pyroglutamylated RFamide peptide receptor

This wide conservation across species suggests the fundamental importance of this receptor system in vertebrate physiology.

What are key differences between rat and human QRFPR?

  • Species-specific differences may exist in tissue distribution patterns

  • Ligand binding affinities may vary between species

  • Signaling pathways and physiological responses could have species-specific characteristics

  • When translating findings from rat models to human applications, these potential differences should be considered

How can QRFPR be targeted for therapeutic development?

The structural and functional insights into QRFPR provide various opportunities for therapeutic development:

  • The detailed binding mode of QRFP26 with QRFPR offers a foundation for rational drug design

  • The flexible region in the peptide binding pocket (around Ser23) presents an opportunity for optimizing peptide activity, as demonstrated by substituting Ser23 with bulkier norvaline leading to enhanced peptide analogs

  • Targeting QRFPR may be relevant for conditions related to:

    • Metabolic disorders

    • Appetite regulation

    • Energy homeostasis

  • Understanding the unique binding mechanisms of QRFPR compared to other RF-amide peptide receptors allows for developing selective compounds that don't cross-react with related receptors

What are effective approaches for measuring QRFPR activation in experimental settings?

Based on published research methodologies, several approaches can be used to measure QRFPR activation:

  • Functional assays measuring Gq-mediated signaling responses, such as calcium mobilization

  • Bioluminescence resonance energy transfer (BRET) or NanoBiT-based assays for monitoring protein-protein interactions between QRFPR and G proteins

  • Cryo-EM analysis of receptor-G protein complexes for structural confirmation of activation states

  • Mutagenesis experiments targeting key residues involved in receptor activation, followed by functional readouts

What are the main challenges in expressing and purifying recombinant rat Qrfpr?

Researchers working with recombinant Qrfpr should be aware of several technical challenges:

  • As a 7-transmembrane GPCR, Qrfpr presents typical challenges associated with membrane protein expression and purification

  • Maintaining proper folding and functional activity during recombinant expression requires careful optimization

  • For structural studies, strategies such as fusion with stabilizing domains (e.g., cytochrome b562RIL) have been beneficial

  • Complex formation with G proteins and ligands typically requires co-expression systems or efficient reconstitution methods

What quality control measures are essential when working with recombinant Qrfpr?

Quality control for recombinant Qrfpr research should include:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.