Recombinant Rat Receptor expression-enhancing protein 4 (Reep4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. Please indicate your desired tag type for preferential development.
Synonyms
Reep4; Receptor expression-enhancing protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Reep4
Target Protein Sequence
MVSWMICRLVVLIFGMLYPAYASYKAVKSKNIREYVRWMMYWIVFAIFMAAETFTDIFIS WFPFYYEIKMAFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDACIVQAKERSYETMLS FGKRSLNMAASAAVQAATKSQGALAGRLRSFSMQDLRSIPDTSAPTYQDPLYLEDQAPRR RPPIGYRPGGLQDSDTEDECWSDNEIAPQPPVRPREKPLSRSQSLRVVKRKPLVREGTSR SLKVRTRKKTIPSDLDS
Uniprot No.

Target Background

Function

Recombinant Rat Receptor expression-enhancing protein 4 (Reep4) is a microtubule-binding protein crucial for proper cell division and nuclear envelope reassembly. Its function involves sequestering the endoplasmic reticulum away from chromosomes during mitosis, likely by clearing the endoplasmic reticulum membrane from metaphase chromosomes.

Database Links
Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Receptor Expression-Enhancing Protein 4 (Reep4) and what is its primary function in rat cells?

Reep4 (UniProt accession: Q4QQW1) is a reticulon homology domain protein that functions as a critical component in nuclear pore complex (NPC) biogenesis. It belongs to the REEP protein family and plays a dual role by localizing to both the high-curvature membrane of the cytoplasmic endoplasmic reticulum and the inner nuclear membrane (INM) . Reep4's primary functions include promoting NPC assembly, particularly during mitosis, and potentially providing high-curvature ER membrane to nascent NPCs . The protein appears to serve as a molecular link between high-curvature ER and ELYS-based NPC seeds, facilitating proper nuclear envelope formation during late mitotic stages .

What are the known post-translational modifications of rat Reep4?

Based on available data, rat Reep4 undergoes phosphorylation at serine residue 152 (S152) . This modification has been documented in phosphoproteomics studies, though the specific kinases responsible and the functional consequences of this phosphorylation event require further investigation. Post-translational modifications likely regulate Reep4's interactions with binding partners and its subcellular localization patterns.

How does rat Reep4 compare to Reep4 in other species?

While the search results don't provide direct comparative information between rat Reep4 and its orthologs in other species, the evolutionary conservation of nuclear pore components suggests functional similarity across mammals. Species-specific differences in receptor expression and function are common, as demonstrated with other receptor proteins . Comprehensive sequence alignment and functional studies comparing rat Reep4 with human and mouse orthologs would provide valuable insights into conserved domains and species-specific adaptations.

Where is Reep4 primarily localized within rat cells?

Reep4 exhibits a dual localization pattern within rat cells. It is found at:

  • The cytoplasmic endoplasmic reticulum (ER), particularly in high-curvature membrane regions, consistent with its reticulon homology domain protein classification

  • The inner nuclear membrane (INM), where it functions in nuclear pore complex formation

This dual localization pattern is functionally significant, as it allows Reep4 to participate in both ER membrane shaping and nuclear pore biogenesis. Advanced imaging studies using stimulated emission depletion (STED) microscopy have revealed that Reep4 frequently colocalizes with ELYS on ring-like structures, consistent with their association at nuclear pores .

What mechanisms control Reep4 targeting to the inner nuclear membrane?

The accumulation of Reep4 at the inner nuclear membrane is regulated primarily through its interaction with ELYS, a nucleoporin that serves as a critical determinant of NPC biogenesis . Experimental evidence from RNAi studies demonstrates that:

  • ELYS depletion results in a marked reduction of Reep4 signal at the nuclear rim

  • The percentage of cells showing Reep4 at the INM drops from 89% in control cells to 44% in ELYS-depleted cells

  • The fraction of Reep4 localizing to the INM decreases by 60% upon ELYS depletion

This ELYS-dependent targeting appears to be specific to Reep4, as most other INM proteins (SUN2, Emerin, Lap2β) localize normally in ELYS-depleted cells. The mechanistic details of ELYS-mediated Reep4 targeting remain to be fully elucidated, with two potential pathways: direct interaction during nuclear reformation in anaphase or passive diffusion through NPC peripheral channels followed by ELYS-mediated retention at the INM during interphase .

What proteins does rat Reep4 interact with, and what are their functional relationships?

Proximity-dependent biotin identification (BioID) studies have identified several Reep4-proximal proteins, suggesting potential functional interactions . The key interaction partners include:

ProteinInteraction EvidenceFunctional Relationship
ELYSMost strongly enriched proximal protein; colocalization confirmed by STED microscopyPromotes Reep4 targeting to INM; cooperates in NPC biogenesis
Rab3GAP1Validated interaction partnerKnown REEP4 interaction partners, suggesting potential roles in membrane trafficking
Rab3GAP2Validated interaction partnerSee above
14-3-3 proteinsValidated interaction partnerMay mediate phosphorylation-dependent signaling
Nup153Found proximal to Reep4 by BioIDNucleoporin that may associate with Reep4 at NPCs

These interactions collectively suggest that Reep4 functions within a network of proteins involved in nuclear pore complex formation, membrane shaping, and potentially membrane trafficking .

How does Reep4 cooperate with ELYS in nuclear pore complex assembly?

Reep4 and ELYS cooperate in nuclear pore complex (NPC) biogenesis, particularly during the late stages of mitosis. Their functional relationship appears to involve:

  • ELYS recruitment of Reep4 to the inner nuclear membrane, providing a molecular link between the NPC seed and the nuclear envelope

  • Reep4 potentially providing high-curvature ER membrane to nascent NPCs through its reticulon homology domain

  • Coordinated activity that promotes proper NPC assembly during nuclear envelope reformation

Experimental evidence indicates that Reep4 depletion results in decreased levels of nucleoporins from different NPC subcomplexes, suggesting that Reep4 is required for normal NPC levels . The precise molecular mechanism of how Reep4 contributes to NPC assembly remains an active area of investigation.

What are the recommended methods for expressing and purifying recombinant rat Reep4?

While the search results don't provide specific protocols for Reep4 expression and purification, standard approaches for recombinant membrane proteins would likely be applicable. Based on research practices with similar proteins, the following methodological considerations are important:

  • Expression systems: E. coli, insect cells (Sf9, High Five), or mammalian cells (HEK293, CHO)

  • Fusion tags: His6, GST, or MBP tags to facilitate purification and potentially enhance solubility

  • Detergent selection: Critical for membrane protein extraction while maintaining native structure

  • Refolding strategies: May be necessary if expression yields insoluble inclusion bodies

Researchers should optimize conditions specific to rat Reep4, considering its membrane-associated nature and potential for aggregation.

What imaging techniques are most effective for studying Reep4 localization and dynamics?

Advanced imaging techniques have proven valuable for characterizing Reep4 localization and dynamics. Based on published research, recommended approaches include:

  • Stimulated emission depletion (STED) microscopy: Used successfully to visualize Reep4 and ELYS colocalization at ring-like structures consistent with nuclear pores

  • Proximity-dependent biotin identification (BioID): Employed to characterize the immediate molecular environment of Reep4 by identifying proximal proteins

  • TEV protease cleavage assays: Used to determine the presence of Reep4 at the inner nuclear membrane

For live-cell dynamics, techniques such as fluorescence recovery after photobleaching (FRAP) or photoactivatable/photoconvertible fluorescent protein fusions would likely provide valuable insights into Reep4 mobility and turnover rates.

How might the reticulon homology domain of Reep4 contribute to nuclear pore complex curvature?

The reticulon homology domain (RHD) of Reep4 specializes in generating and stabilizing membrane curvature, typically in the endoplasmic reticulum. In the context of nuclear pore complex formation, this domain likely plays a critical role in:

  • Providing high-curvature membrane elements necessary for the sharp bends in nuclear envelope that characterize nuclear pores

  • Stabilizing the curved membrane structures during NPC assembly

  • Potentially recruiting additional factors necessary for proper pore formation

Future research might address how the RHD of Reep4 works in concert with other membrane-curving proteins and nucleoporins to achieve the precise geometry required for functional nuclear pores. Structural studies examining the interaction between the Reep4 RHD and nuclear membrane components would provide valuable insights.

What is the relationship between Reep4 phosphorylation at S152 and its function in nuclear pore complex assembly?

While phosphorylation of rat Reep4 at serine 152 has been documented , the functional significance of this modification in relation to nuclear pore complex assembly remains unexplored. Potential research questions include:

  • Which kinases and phosphatases regulate S152 phosphorylation?

  • Does phosphorylation state affect Reep4's interaction with ELYS or other binding partners?

  • Is S152 phosphorylation cell cycle-regulated, particularly during mitosis when NPC assembly occurs?

  • How does phosphorylation influence Reep4's localization between ER and inner nuclear membrane?

Phosphomimetic (S152D/E) and phosphodeficient (S152A) mutants could help elucidate the role of this modification in Reep4 function.

How does Reep4 function differ between interphase and mitotic NPC assembly pathways?

Nuclear pore complexes can assemble through two distinct pathways: within an intact nuclear envelope during interphase or concomitantly with nuclear envelope reformation during mitosis. Current evidence suggests that Reep4 "appears to be particularly important for NPC formation during mitosis" . Advanced research questions include:

  • What mechanisms restrict or enhance Reep4 activity during different cell cycle phases?

  • Are there mitosis-specific Reep4 interaction partners that are absent during interphase?

  • How is Reep4 redistributed during nuclear envelope breakdown and reformation?

  • Can Reep4 function be compensated by other REEP family members in either pathway?

Comparative studies examining Reep4 dynamics and interactions during interphase versus mitosis would provide insights into its pathway-specific functions.

What are common challenges when studying recombinant rat Reep4 and how can they be overcome?

Membrane proteins like Reep4 present several experimental challenges:

  • Protein solubility and aggregation: Membrane proteins often aggregate when overexpressed

    • Solution: Optimize expression conditions, use solubility-enhancing tags, or develop native purification methods

  • Maintaining native conformation: Detergents used for extraction can disrupt protein structure

    • Solution: Screen multiple detergents or consider nanodiscs/liposomes for reconstitution

  • Low expression yields: Membrane proteins typically express at lower levels than soluble proteins

    • Solution: Consider specialized expression systems or codon-optimized constructs

  • Functional assays: Determining activity outside the cellular context can be challenging

    • Solution: Develop in vitro assays that recapitulate key aspects of Reep4 function, such as membrane curvature induction

How can researchers accurately distinguish between cytoplasmic ER and INM pools of Reep4?

Distinguishing between cytoplasmic ER and inner nuclear membrane (INM) pools of Reep4 requires specialized approaches. Based on published methodologies, the following techniques are recommended:

  • TEV protease cleavage assays: As used in the referenced study, this approach can quantitatively determine the fraction of a protein present at the INM

  • Super-resolution microscopy: Techniques such as STED, STORM, or PALM provide the resolution necessary to distinguish between perinuclear ER and the INM

  • Biochemical fractionation: Carefully optimized protocols can separate nuclear membranes from ER membranes, though cross-contamination is a concern

  • Proximity labeling with compartment-specific markers: BioID or APEX2 fusions with known INM or ER proteins can help map the distribution of Reep4

Researchers should consider combining multiple approaches to obtain the most reliable results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.