Recombinant Rat Receptor expression-enhancing protein 5 (Reep5)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Reep5; Dp1; Receptor expression-enhancing protein 5; Polyposis locus protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MSAAMRERFDRFLHEKNCMTDLLAKLEAKTGVNRSFIALGVIGLVALYLVFGYGASLLCN LIGFGYPAYISMKAIESPNKDDDTQWLTYWVVYGVFSIAEFFSDLFLSWFPFYYMLKCGF LLWCMAPSPSNGAELLYRRVIRPIFLKHESQVDSVVKDVKDKAKETADAISKEVKKATVN LLGDEKKST
Uniprot No.

Target Background

Function
May enhance functional cell surface expression of olfactory receptors.
Database Links
Protein Families
DP1 family
Subcellular Location
Membrane; Multi-pass membrane protein. Endoplasmic reticulum.

Q&A

What is the established function of REEP5 in cardiac physiology?

REEP5 functions primarily as a sarco-endoplasmic reticulum membrane sculptor that modulates cardiac function. It maintains SR/ER structural integrity, which is essential for proper calcium handling and cardiac contractility. REEP5 expression is notably decreased in failing hearts and in the left ventricle of myocardial infarction (MI) models, suggesting its critical role in normal cardiac physiology. REEP5 depletion has been demonstrated to cause SR/ER membrane destabilization and luminal vacuolization, leading to decreased myocyte contractility and disrupted calcium handling . These findings emphasize REEP5's importance in maintaining cardiac structural and functional integrity.

How can researchers effectively overexpress REEP5 in experimental cardiac models?

Researchers can achieve REEP5 overexpression through several established methodologies:

  • Plasmid-based overexpression: Transfection of REEP5 overexpression plasmids into cardiomyocytes for in vitro studies can be performed using standard transfection reagents optimized for cardiac cells. This approach has proven effective in hypoxia-induced cardiomyocyte models, with expression verification typically performed via western blot analysis after 24 hours of transfection .

  • Viral vector delivery: For in vivo studies, adeno-associated virus (AAV) vectors encoding REEP5 can be delivered through direct myocardial injection or intravenous administration. This method has been successfully employed in mouse MI models to assess cardioprotective effects .

  • Assessment of overexpression efficiency: Western blot analysis and immunohistochemistry (IHC) staining are standard techniques to verify successful overexpression, particularly in the infarct penumbra area in MI models .

When implementing these approaches, researchers should carefully consider experimental timing, as REEP5 overexpression exhibits maximal protective effects when introduced prior to hypoxic challenge or MI induction .

What experimental methods are recommended for studying REEP5 membrane topology?

Understanding REEP5 membrane topology requires multiple complementary approaches:

  • Computational prediction: Initial screening with multi-algorithm prediction tools such as TOPCONS is recommended. For human REEP5, these tools have identified a cytosolic N-terminus with 2-4 predicted transmembrane helices .

  • Membrane yeast two-hybrid (MYTH) system: This technique provides experimental validation of topology predictions by exploiting ubiquitin fragment reconstitution. Using N-terminal TF transcription factor tagged (TF-Cub) bait protein and ubiquitin fragments tagged (NubI) prey protein enables researchers to determine protein orientation within membranes .

  • Fusion protein constructs: Creating fusion constructs with marker proteins of known orientation (e.g., Ost1p in yeast) can help determine which protein domains face the cytosol versus the ER lumen .

These methods should be used in combination, as single-technique approaches may yield incomplete or potentially misleading results regarding membrane protein orientation .

What molecular mechanisms mediate REEP5's protection against ER stress during myocardial infarction?

REEP5 protects against ER stress during myocardial infarction through multiple coordinated mechanisms:

  • Inhibition of ER stress sensor activation: REEP5 overexpression suppresses the phosphorylation of key ER stress sensors PERK and IRE1α while reducing nuclear translocation of ATF6. This effectively inhibits all three branches of the canonical unfolded protein response (UPR) .

  • Downregulation of proapoptotic factors: REEP5 significantly decreases the expression of Chop and cleaved caspase-12, two critical mediators of ER stress-induced apoptosis. This has been confirmed both in vitro in hypoxic cardiomyocytes and in vivo in MI mouse models .

  • CLEC5A interaction: REEP5 directly binds to C-type lectin member 5A (CLEC5A), a protein that triggers cardiac dysfunction. This binding appears to counteract CLEC5A's promotion of cardiomyocyte apoptosis under hypoxic conditions. Notably, REEP5 overexpression abolishes CLEC5A-mediated ER stress-induced apoptosis .

  • Reduction of GRP78 and XBP-1s levels: Under hypoxic conditions, REEP5 overexpression attenuates the increase in GRP78 (the master regulator of UPR) expression and active spliced XBP-1 (XBP-1s) levels, further confirming its role in mitigating ER stress responses .

These protective mechanisms collectively contribute to improved left ventricular function and reduced infarct size in MI models, highlighting REEP5's potential as a therapeutic target .

How does the REEP5-CLEC5A interaction specifically modulate cardiomyocyte survival under hypoxic conditions?

The interaction between REEP5 and CLEC5A represents a critical regulatory axis for cardiomyocyte survival under hypoxic conditions through several interconnected mechanisms:

  • Protein binding and degradation: Research has demonstrated that CLEC5A directly binds to REEP5 and promotes its protein degradation. This interaction appears to be a key regulatory mechanism, as CLEC5A overexpression decreases REEP5 protein levels .

  • Transcriptional regulation: Beyond protein degradation, CLEC5A also decreases REEP5 mRNA levels, suggesting additional transcriptional regulatory mechanisms. This may involve CLEC5A-mediated regulation of transcription factors such as NFATC1, which has potential binding sites in the REEP5 promoter region .

  • Opposing effects on ER stress pathways: Under hypoxic conditions, CLEC5A expression increases and promotes ER stress-associated apoptosis. Conversely, REEP5 attenuates these effects by inhibiting the phosphorylation of ER stress sensors and downstream proapoptotic signaling .

  • Functional antagonism: REEP5 overexpression effectively counteracts the deleterious effects of CLEC5A on cardiomyocyte survival, establishing a functional antagonism between these proteins. This finding suggests that the REEP5:CLEC5A ratio may be a critical determinant of cardiomyocyte fate during hypoxic stress .

Understanding this interaction provides significant insights into the molecular mechanisms underlying myocardial infarction pathophysiology and potentially identifies novel therapeutic targets for intervention .

What methodological approaches are most effective for studying REEP5's impact on SR/ER membrane organization?

Studying REEP5's impact on SR/ER membrane organization requires sophisticated methodological approaches:

  • Electron microscopy techniques:

    • Transmission electron microscopy (TEM) is essential for visualizing SR/ER ultrastructure and detecting membrane abnormalities such as vacuolization following REEP5 depletion

    • Immuno-electron microscopy can localize REEP5 within the SR/ER compartments with nanometer precision

  • Live-cell imaging with fluorescent protein markers:

    • SR/ER-targeted fluorescent proteins can be used to monitor dynamic changes in SR/ER morphology in response to REEP5 manipulation

    • FRAP (Fluorescence Recovery After Photobleaching) analysis can assess SR/ER membrane continuity and protein mobility

  • Biochemical fractionation:

    • Differential centrifugation followed by western blotting can determine REEP5 distribution across SR/ER subdomains

    • Protease protection assays can help determine REEP5 topology and interaction with other SR/ER proteins

  • Functional readouts:

    • Calcium imaging using fluorescent indicators (Fluo-4, Fura-2) to measure SR/ER calcium handling

    • Contractility measurements in isolated cardiomyocytes to correlate SR/ER structural changes with functional outcomes

These complementary approaches provide a comprehensive assessment of how REEP5 influences SR/ER membrane architecture and function in cardiac cells .

What are the key technical considerations when using recombinant REEP5 proteins for studying protein-protein interactions?

When using recombinant REEP5 proteins to study protein-protein interactions, researchers should consider these critical technical aspects:

  • Expression system selection:

    • Mammalian expression systems are preferable for maintaining proper post-translational modifications

    • E. coli systems may be suitable for truncated versions lacking transmembrane domains

    • The search results indicate availability of recombinant REEP5 from multiple expression systems including E. coli, mammalian cells, and wheat germ

  • Protein tagging strategies:

    • Multiple tag options are available including His, GST, Fc, DDK, Myc, and Avi tags

    • Tag position (N- vs C-terminal) can significantly impact folding and interaction capacity

    • Consider using cleavable tags to remove them after purification

  • Membrane protein solubilization:

    • Careful selection of detergents is critical for maintaining REEP5's native conformation

    • Mild non-ionic detergents (DDM, LMNG) or lipid nanodiscs may better preserve interaction capacity

    • Consider using crosslinking approaches before solubilization to capture transient interactions

  • Validation techniques:

    • Multiple complementary methods should be employed including co-immunoprecipitation, MYTH system, and proximity labeling techniques

    • The membrane yeast two-hybrid (MYTH) system has been successfully used to study REEP5 topology and could be adapted for interaction studies

    • Biological validation in relevant cardiac cell models is essential to confirm interactions identified in vitro

These considerations help ensure that protein-protein interaction studies with recombinant REEP5 yield physiologically relevant results that accurately reflect the protein's behavior in vivo .

How can researchers quantitatively assess the effect of REEP5 on cardiomyocyte function in hypoxia models?

Quantitative assessment of REEP5's effects on cardiomyocyte function in hypoxia models requires sophisticated methodological approaches:

  • Apoptosis quantification:

    • TUNEL assay has been effectively used to quantify cardiomyocyte apoptosis in hypoxia models with or without REEP5 overexpression

    • Flow cytometry with Annexin V/PI staining provides quantitative measurement of early and late apoptotic cell populations

    • The research shows that hypoxia significantly increases TUNEL-positive cells, while REEP5 overexpression abolishes this effect

  • Cardiac functional parameters:

    • Echocardiography provides critical measurements including:

      • Left ventricular end-systolic diameter (LVESD)

      • Left ventricular end-systolic volume (LVESV)

      • Left ventricular end-diastolic diameter (LVEDD)

      • Left ventricular end-diastolic volume (LVEDV)

      • Ejection fraction (EF)

      • Fractional shortening (FS)

    • These parameters effectively quantify the protective effects of REEP5 overexpression in MI models

  • Infarct size measurement:

    • TTC (2,3,5-triphenyltetrazolium chloride) staining allows for precise quantification of infarct area

    • Infarct proportion (percentage of total heart volume) provides a standardized measure to compare experimental groups

    • Research demonstrates that REEP5 overexpression significantly reduces infarct size in MI models

  • ER stress markers quantification:

    • Western blot analysis with densitometry to quantify:

      • GRP78 expression

      • Phosphorylation levels of PERK and IRE1α

      • Nuclear translocation of ATF6

      • XBP-1s levels

      • Chop and cleaved caspase-12 levels

    • These molecular markers provide mechanistic insights into how REEP5 modulates ER stress responses

This multilevel assessment approach provides comprehensive quantitative data on both the functional and molecular effects of REEP5 in cardiac hypoxia models.

What are the optimal experimental conditions for studying REEP5 function in hypoxia-induced cardiomyocyte models?

Optimizing experimental conditions for studying REEP5 in hypoxia-induced cardiomyocyte models requires careful consideration of multiple parameters:

  • Hypoxia induction protocol:

    • Oxygen concentration: 1-2% O₂ is typically used to simulate pathological hypoxia in cardiomyocytes

    • Duration: 24 hours of hypoxia has been shown effective for studying REEP5-related effects

    • Gas composition: A mixture of 1% O₂, 5% CO₂, and 94% N₂ in a controlled hypoxia chamber

  • Cell models:

    • Primary rat or mouse cardiomyocytes provide physiologically relevant models

    • H9C2 rat cardiac myoblast cell line offers a more standardized alternative

    • Immortalized cardiomyocyte cell lines should be validated against primary cells

  • REEP5 manipulation timing:

    • For overexpression studies: Transfection of REEP5 expression plasmids 24 hours prior to hypoxia exposure

    • For knockdown studies: siRNA transfection 48-72 hours prior to hypoxia to ensure sufficient protein depletion

    • Validation of expression changes by western blot is essential before hypoxia exposure

  • Key readout timepoints:

    • ER stress markers: Assessment at 6-12 hours of hypoxia captures early stress responses

    • Apoptosis markers: TUNEL assay and cleaved caspase measurements at 24 hours of hypoxia

    • Protein interaction studies: Typically performed after 12-24 hours of hypoxia

These optimized conditions have been validated in published research examining REEP5's protective effects against hypoxia-induced cardiomyocyte injury .

How can researchers effectively model the REEP5-CLEC5A interaction in experimental systems?

Modeling the REEP5-CLEC5A interaction requires specialized experimental approaches:

  • Co-immunoprecipitation (Co-IP) studies:

    • Endogenous Co-IP: Using antibodies against native REEP5 or CLEC5A in cardiac tissue or cell lysates

    • Tagged protein Co-IP: Utilizing epitope-tagged versions (His, GST, Myc) of REEP5 and CLEC5A

    • Crosslinking approaches may help capture transient interactions prior to cell lysis

  • Proximity-based interaction assays:

    • Bimolecular Fluorescence Complementation (BiFC): Fusing complementary fragments of fluorescent proteins to REEP5 and CLEC5A

    • FRET/BRET approaches: For studying real-time interactions in living cells

    • Proximity Ligation Assay (PLA): For visualizing endogenous protein interactions with subcellular resolution

  • Protein degradation analysis:

    • Cycloheximide chase assays: To confirm CLEC5A-mediated degradation of REEP5

    • Proteasome inhibitors (MG132): To determine if degradation is proteasome-dependent

    • Ubiquitination assays: To detect REEP5 ubiquitination in response to CLEC5A expression

  • Functional interaction models:

    • Dual overexpression/knockdown approaches: Combining REEP5 overexpression with CLEC5A manipulation

    • Domain mapping: Creating truncated versions of both proteins to identify interaction interfaces

    • Rescue experiments: Testing if REEP5 overexpression can reverse CLEC5A-induced phenotypes

Research has demonstrated that CLEC5A binds with REEP5 and promotes its protein degradation, while REEP5 mediates CLEC5A function in ER stress-associated apoptosis, making this interaction a valuable therapeutic target .

What are the preferred methods for quantifying REEP5 expression changes in cardiac tissue samples?

Quantifying REEP5 expression in cardiac tissue requires complementary approaches for comprehensive assessment:

  • Protein expression analysis:

    • Western blotting: The gold standard for quantifying REEP5 protein levels

      • Proper normalization to loading controls (GAPDH, β-actin)

      • Densitometric analysis for statistical comparison

    • Immunohistochemistry (IHC): For spatial localization within cardiac tissue

      • Particularly valuable for assessing REEP5 in infarct penumbra areas

      • Can be combined with co-localization studies for SR/ER markers

  • mRNA expression analysis:

    • RT-qPCR: For precise quantification of REEP5 transcript levels

      • Requires careful primer design spanning exon-exon junctions

      • Normalization to multiple reference genes (18S rRNA, GAPDH)

    • RNA-seq: For comprehensive transcriptomic profiling

      • Can reveal regulatory networks affecting REEP5 expression

      • The GSE114695 dataset has been used to identify REEP5 downregulation in MI

  • Single-cell analysis techniques:

    • scRNA-seq: For cell-type specific expression patterns

    • Single-cell western blot: For protein-level heterogeneity assessment

    • These approaches are particularly valuable for understanding cell-specific responses

  • Validation in multiple experimental models:

    • Mouse MI models created by ligation of the left anterior descending artery

    • In vitro hypoxia-induced cardiomyocyte models

    • Human heart failure tissue samples when available

Research has shown that REEP5 levels are significantly decreased both in the left ventricle of MI mice and in hypoxia-exposed cardiomyocytes, highlighting the importance of accurate quantification methods .

What are common challenges in purifying functional recombinant REEP5 protein and how can they be addressed?

Purifying functional recombinant REEP5 presents several challenges due to its membrane protein nature:

  • Expression system selection challenges:

    • Challenge: Bacterial systems often yield misfolded REEP5 due to lack of proper post-translational modifications

    • Solution: Utilize eukaryotic expression systems (mammalian cells, insect cells) that provide appropriate ER environment

    • Alternative approach: Consider wheat germ cell-free expression systems which have been successfully used for REEP5

  • Solubilization issues:

    • Challenge: Harsh detergents may disrupt REEP5's native conformation

    • Solution: Screen multiple mild detergents (DDM, LMNG, CHAPS) at various concentrations

    • Advanced approach: Consider lipid nanodisc incorporation to maintain REEP5 in a near-native lipid environment

  • Purification yield and stability:

    • Challenge: Low yields and protein instability during purification

    • Solution: Optimize buffer conditions including pH, salt concentration, and addition of glycerol

    • Best practice: Include protease inhibitors throughout purification and minimize freeze-thaw cycles

  • Tag interference:

    • Challenge: Tags may interfere with REEP5 folding or function

    • Solution: Compare multiple tag options (His, GST, Fc, DDK, Myc) and positions (N- vs C-terminal)

    • Validation approach: Verify protein functionality with and without tag cleavage

These optimization strategies help ensure that purified recombinant REEP5 maintains its native structure and functional properties for downstream applications.

How can researchers address variability in REEP5 expression across different cardiac disease models?

Addressing variability in REEP5 expression across cardiac disease models requires systematic approaches:

  • Standardization of disease model protocols:

    • Challenge: Different MI induction techniques may affect REEP5 expression patterns

    • Solution: Standardize surgical procedures for left anterior descending artery ligation

    • Best practice: Document precise anatomical ligation location and duration of ischemia

  • Temporal expression profiling:

    • Challenge: REEP5 expression may vary dynamically throughout disease progression

    • Solution: Establish time-course experiments with multiple sampling points

    • Key finding: Research shows REEP5 downregulation in the infarct penumbra area of MI mice, but temporal dynamics need further characterization

  • Regional expression heterogeneity:

    • Challenge: REEP5 expression varies between infarct core, border zone, and remote myocardium

    • Solution: Use laser capture microdissection to isolate specific cardiac regions

    • Advanced approach: Single-cell RNA-seq to capture cell-specific expression patterns

  • Cross-model validation:

    • Challenge: Different models (ischemia-reperfusion vs. permanent occlusion) may show different REEP5 patterns

    • Solution: Compare multiple experimental models and human tissue samples

    • Integrative approach: Correlate findings from GSE114695 expression profile with additional datasets and in vitro hypoxia models

What emerging technologies could advance our understanding of REEP5's role in cardiac membrane organization?

Emerging technologies poised to deepen our understanding of REEP5's role in cardiac membrane organization include:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of REEP5's integration within SR/ER membranes at near-atomic resolution

    • Could reveal how REEP5 mechanistically sculpts SR/ER membrane curvature

    • May uncover structural changes in REEP5 during cardiac stress conditions

  • Super-resolution microscopy techniques:

    • STORM/PALM imaging can visualize REEP5 distribution with 10-20 nm resolution

    • Expansion microscopy provides enhanced visualization of REEP5's relationship with other SR/ER proteins

    • Multi-color STED microscopy allows simultaneous visualization of REEP5 with interaction partners

  • Organoid and engineered heart tissue technologies:

    • Human cardiac organoids provide physiologically relevant models for REEP5 research

    • Engineered heart tissues enable functional assessment of REEP5 manipulation

    • Integration with microfluidic "heart-on-chip" platforms for dynamic stress testing

  • CRISPR-based genomic screening:

    • CRISPRi/CRISPRa libraries to identify genetic modifiers of REEP5 function

    • Base editing for precise manipulation of REEP5 regulatory elements

    • Prime editing for modeling disease-associated REEP5 variants

These technologies promise to bridge current knowledge gaps regarding how REEP5 maintains SR/ER integrity and how its dysregulation contributes to cardiac pathophysiology .

How might targeting the REEP5-CLEC5A axis translate into therapeutic strategies for myocardial infarction?

The REEP5-CLEC5A interaction presents promising therapeutic opportunities for myocardial infarction:

  • Peptide-based interference strategies:

    • Development of peptides that mimic REEP5 binding interfaces to competitively inhibit CLEC5A interaction

    • Cell-penetrating peptides could deliver REEP5-mimetic sequences to cardiomyocytes

    • Peptide stabilization techniques (cyclization, stapling) may enhance therapeutic potential

  • Small molecule modulators:

    • High-throughput screening to identify compounds that:

      • Enhance REEP5 stability or prevent CLEC5A-mediated degradation

      • Disrupt CLEC5A binding to REEP5 without affecting REEP5's protective functions

      • Upregulate endogenous REEP5 expression in cardiac tissue

  • RNA-based therapeutic approaches:

    • REEP5 mRNA delivery strategies for rapid protein expression

    • miRNA modulators targeting REEP5 regulatory networks

    • siRNA approaches to downregulate CLEC5A in acute MI settings

  • Combined pathway targeting:

    • Simultaneous modulation of REEP5-CLEC5A and ER stress pathways

    • Targeting NFATC1-mediated transcriptional regulation of REEP5

    • Integration with established cardioprotective strategies

Research has demonstrated that REEP5 overexpression protects against MI by reducing infarct size and improving left ventricular function. The REEP5-CLEC5A axis specifically mediates protection against ER stress-induced apoptosis, suggesting that therapeutic strategies targeting this interaction could provide significant cardioprotection in MI patients .

How does REEP5 function compare across different species models in cardiac research?

Comparative analysis of REEP5 across species reveals important evolutionary conservation and divergence:

SpeciesREEP5 HomologyKey Experimental FindingsResearch Applications
HumanReference sequenceMembrane topology with cytosolic N-terminus confirmed by multi-algorithm prediction and MYTH systemClinical correlation studies, genetic association analyses
Mouse~95% amino acid identityDownregulation in MI models; overexpression improves left ventricular function and reduces infarct sizePrimary in vivo MI models, transgenic approaches
Rat~94% amino acid identityCritical for cardiomyocyte survival under hypoxic conditionsPrimary cardiomyocyte isolation, hypoxia models
Zebrafish~75% amino acid identityEmerging model for REEP5 developmental studiesHigh-throughput screening, developmental cardiac studies

Across these species, REEP5 consistently demonstrates:

  • Enrichment in cardiac tissue

  • Critical role in SR/ER membrane organization

  • Protective function against ER stress-induced apoptosis

  • Interaction with CLEC5A (where studied)

  • Relative expression levels across cardiac chambers

  • Developmental expression patterns

  • Response magnitude to pathological stressors

This cross-species analysis provides valuable insights for selecting appropriate experimental models and translating findings toward human therapeutic applications .

What distinguishes REEP5 functionally from other members of the REEP protein family in cardiac tissue?

REEP5 exhibits distinct characteristics compared to other REEP family members in cardiac tissue:

REEP Family MemberCardiac ExpressionPrimary FunctionMembrane TopologyDisease Association
REEP5Highly enrichedSR/ER membrane sculptor; protects against ER stress-induced apoptosisCytosolic N-terminus; 2-4 transmembrane domainsDecreased in MI and heart failure
REEP1Low expressionPrimarily functions in neurons; ER shapingSimilar to REEP5Hereditary spastic paraplegia; minimal cardiac relevance
REEP2Moderate expressionEnhances cell surface expression of olfactory receptorsSimilar to REEP5Hereditary spastic paraplegia; minimal cardiac relevance
REEP3/4Low expressionER network formation during mitosisDifferent membrane insertionNo significant cardiac phenotypes reported
REEP6Moderate expressionImportant in retinal cellsSimilar to REEP5Retinitis pigmentosa; minimal cardiac relevance

REEP5 uniquely:

  • Shows the highest cardiac-specific expression among REEPs

  • Demonstrates specific interaction with CLEC5A in cardiac tissue

  • Exhibits significant downregulation in cardiac pathologies

  • Provides cardioprotection via ER stress modulation

Analysis of gene expression profiles indicates that while multiple REEP family members are expressed in cardiac tissue, REEP5 shows the most significant changes during myocardial infarction, suggesting its specialized role in cardiac pathophysiology .

What is the optimal experimental design for studying REEP5-mediated protection against myocardial infarction?

A comprehensive experimental design for studying REEP5-mediated protection requires a multi-level approach:

  • In vivo MI model design:

    • Experimental groups:

      • Sham operation

      • MI + control vector

      • MI + REEP5 overexpression

      • MI + REEP5 knockout/knockdown

    • Timing considerations:

      • REEP5 manipulation introduced 1-2 weeks before MI induction

      • Functional assessments at acute (1-3 days) and chronic (2-4 weeks) timepoints

    • Surgical approach: Ligation of the left anterior descending artery with standardized anatomical positioning

  • Functional assessments:

    • Echocardiography parameters:

      • LVESD, LVESV, LVEDD, LVEDV measurements

      • EF and FS calculations for systolic function evaluation

    • Hemodynamic measurements:

      • Pressure-volume loop analysis

      • +dP/dt and -dP/dt for contractility assessment

    • Infarct quantification: TTC staining with computerized planimetry

  • Molecular analyses timeline:

    • Early phase (6-24h): ER stress marker activation (PERK, IRE1α, ATF6)

    • Intermediate phase (24-72h): Apoptotic signaling (Chop, cleaved caspase-12)

    • Late phase (1-4 weeks): Fibrosis and remodeling markers

  • Mechanistic investigations:

    • CLEC5A interaction studies:

      • Co-immunoprecipitation from cardiac lysates

      • Proximity ligation assay in tissue sections

    • ER stress pathway analysis:

      • Western blot for phosphorylated PERK and IRE1α

      • Immunofluorescence for ATF6 nuclear translocation

      • RT-qPCR for XBP-1 splicing

This comprehensive design enables robust assessment of REEP5's cardioprotective effects while elucidating underlying molecular mechanisms .

How should researchers interpret contradictory findings between in vitro and in vivo REEP5 expression profiles?

When facing contradictory REEP5 expression findings between in vitro and in vivo systems, researchers should follow this interpretive framework:

  • Methodological reconciliation:

    • Timing discrepancies: In vitro hypoxia typically represents acute stress (24-48h), while in vivo MI models capture both acute and chronic phases

    • Cell type differences: Isolated cardiomyocytes lack interaction with fibroblasts, endothelial cells, and immune cells present in vivo

    • Stress intensity variation: In vitro hypoxia (1-2% O₂) may differ from the complete anoxia in infarcted tissue

  • Systemic factor consideration:

    • Neurohormonal influences: In vivo systems include sympathetic activation and RAAS signaling absent in vitro

    • Inflammatory mediators: The robust inflammatory response in vivo can significantly alter REEP5 expression

    • Metabolic differences: Substrate availability and utilization differ between culture systems and intact heart

  • Experimental validation approaches:

    • Ex vivo models: Langendorff-perfused hearts bridge the gap between in vitro and in vivo systems

    • Co-culture systems: Cardiomyocyte-fibroblast co-cultures better approximate in vivo cellular interactions

    • Temporal profiling: Detailed time-course experiments in both systems may reveal transient expression changes

  • Translational considerations:

    • Human tissue validation: Whenever possible, validate key findings in human cardiac samples

    • Multi-model consensus: Prioritize findings consistent across multiple experimental systems

    • Functional significance: Focus on whether REEP5 manipulation produces consistent functional outcomes despite expression differences

This structured approach helps researchers navigate apparent contradictions and develop more nuanced understanding of REEP5 biology across experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.