Recombinant Rat Receptor-type tyrosine-protein phosphatase R (Ptprr)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Receptor-type Tyrosine-protein Phosphatase R (Ptprr)

Recombinant Rat Receptor-type Tyrosine-protein Phosphatase R (Ptprr) is a bioengineered protein derived from the rat PTPRR gene. It belongs to the receptor-type protein tyrosine phosphatase (RPTP) family, which regulates cellular signaling through tyrosine dephosphorylation . PTPRR functions as a transmembrane phosphatase with extracellular domains (ECDs) and intracellular catalytic domains, modulating signaling pathways critical for cell growth, differentiation, and survival . Recombinant Ptprr is produced in heterologous systems (e.g., E. coli, mammalian cells) for research and therapeutic applications, enabling controlled studies of its enzymatic activity and interactions .

Functional Roles and Mechanisms

Ptprr regulates signaling pathways through substrate-specific dephosphorylation:

  • β-Catenin Inactivation: Dephosphorylates β-catenin at Tyr-142, suppressing Wnt/β-catenin signaling and acting as a tumor suppressor in ovarian cancer .

  • MAP Kinase Modulation: Interacts with MAPK7 (ERK5) and regulates its activity, influencing neuronal differentiation and survival .

  • Cell Adhesion: Associates with cadherins (e.g., E-cadherin) and α-catenin, stabilizing adherens junctions .

Catalytic Mechanism:
Ptprr employs a nucleophilic cysteine (pKa ~5–6) in its P-loop to form a thiophosphate intermediate during substrate dephosphorylation. A conserved aspartate residue facilitates hydrolysis, while an arginine stabilizes the transition state .

Research Applications

Recombinant Ptprr is utilized in:

ApplicationDetailsReferences
Cancer StudiesInvestigates tumor suppression via β-catenin inactivation and cadherin stabilization .
Neurological ResearchExamines roles in neuronal growth and differentiation, regulated by nerve growth factor (NGF) .
Biochemical AssaysMeasures phosphatase activity against tyrosine-phosphorylated substrates (e.g., β-catenin, MAPK7) .

Key Research Findings

  • Ovarian Cancer Suppression: Ptprr overexpression delays tumor growth in vitro and in vivo by dephosphorylating β-catenin, reducing Wnt signaling .

  • Neuronal Regulation: NGF upregulates Ptprr in neurons, suggesting roles in synaptic plasticity and axon guidance .

  • Prognostic Biomarker: Low Ptprr expression correlates with poor prognosis in cancers, highlighting its potential as a diagnostic marker .

Clinical and Preclinical Implications

  • Therapeutic Target: Restoring Ptprr expression may suppress β-catenin-driven cancers (e.g., ovarian, head/neck tumors) .

  • Nerve Regeneration: Ptprr’s inhibition of chondroitin sulfate proteoglycans could enhance axon repair, though faulty targeting may limit applications .

Comparison with Other RPTPs

RPTPSubstratesRegulationDiseases
Ptprrβ-catenin, MAPK7, E-cadherinNGF, proteolysis, isoformsOvarian cancer, neurological disorders
CD45SFKs, JAKGlycosylation, dimerizationAutoimmune diseases
LARβ-catenin, SFKs, EGFRProteolysis, ligand bindingCancer
RPTP-ζβ-catenin, RhoGAPLigand binding, proteolysisParkinson’s disease, ulcers

Data adapted from .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your needs in the order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
Ptprr; Ptp; Receptor-type tyrosine-protein phosphatase R; R-PTP-R; PC12-PTP1; Protein-tyrosine phosphatase PCPTP1; Tyrosine phosphatase CBPTP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-656
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
RNNDHFLAIRQKKSWKPMFIYDHSQDIKKSLDIAQEAYKHNYPAPSEVQISKRHQIVDSAFPRPAYDPSLNLLAASGQDLEIENLPIPAANVIVVTLQMDIDKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKSQIELFVSPGNRKPGEPQALQAEEVLRSLNVDVLRQSLPQFGSIDVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFIIIVTCLMIIYRLKERLQLSFRQDKEKNQEIHLSPIALQQAQSEAKAAHSMVQPDQAPKVLNVVVDPQGQCTPEIRNTASTSVCPSPFRMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAVSTPREKVAMEYLQSASRVLTSPQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDPLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVIGVNECDNYTIRNLVLKRGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFESRLSPETVQ
Uniprot No.

Target Background

Function
Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3, and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex releases the MAPKs for activation and translocation into the nucleus.
Database Links

KEGG: rno:94202

STRING: 10116.ENSRNOP00000006401

UniGene: Rn.6277

Protein Families
Protein-tyrosine phosphatase family, Receptor class 7 subfamily
Subcellular Location
[Isoform 3]: Cytoplasm.; [Isoform 2]: Cytoplasm.; [Isoform 1]: Cytoplasm.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Widely expressed in the brain, most abundant in cerebellum, midbrain, cerebral cortex and hippocampus. Also expressed in heart and skeletal muscle.

Q&A

What is Recombinant Rat Receptor-type tyrosine-protein phosphatase R (Ptprr)?

Recombinant Rat Receptor-type tyrosine-protein phosphatase R (Ptprr) is a transmembrane protein tyrosine phosphatase that plays crucial roles in multiple signaling pathways, particularly the MAPK/ERK1/2 cascade. It belongs to the family of receptor-type protein tyrosine phosphatases with expression primarily in neural tissues. Structurally, Ptprr contains an extracellular domain, a transmembrane region, and an intracellular phosphatase domain responsible for its catalytic activity. Its primary function involves dephosphorylating specific tyrosine residues on target proteins, thereby regulating their activity .

The recombinant form of Ptprr is produced through molecular cloning techniques where the Ptprr gene is isolated from rat tissues, inserted into expression vectors, and expressed in suitable host systems to produce functional protein for research applications.

How does Ptprr regulate MAPK/ERK signaling pathways?

Ptprr functions as a negative regulator of the MAPK/ERK signaling cascade through direct dephosphorylation of ERK1/2. In experimental models:

  • Under basal conditions, Ptprr maintains low ERK1/2 phosphorylation levels through its phosphatase activity

  • In Ptprr knockout models, significantly elevated ERK1/2 phospholevels are observed under basal conditions

  • This regulatory mechanism is particularly critical in neurons, where precise control of MAPK/ERK signaling is essential for proper development and synaptic plasticity

The mechanism involves:

  • Direct binding of Ptprr to phosphorylated ERK1/2

  • Dephosphorylation of the TXY activation motif in ERK1/2

  • Subsequent attenuation of downstream signaling events

Gene ontology data confirms Ptprr's involvement in negative regulation of ERK1 and ERK2 cascade, supported by both computational predictions and experimental evidence .

What experimental approaches are most effective for detecting Ptprr expression?

Researchers can employ multiple complementary techniques to detect and quantify Ptprr expression:

Western Blotting:

  • Use specific anti-Ptprr antibodies (similar to techniques used for PTP gamma detection)

  • Sample preparation should include careful lysis of neural tissues using phosphatase inhibitor-containing buffers

  • Expected molecular weight: approximately 75-80 kDa for the full-length protein

  • Controls should include known Ptprr-expressing tissues/cell lines and Ptprr-knockout samples

Quantitative Real-Time PCR:

  • Design primers specific to rat Ptprr mRNA sequences

  • Normalize expression to appropriate housekeeping genes (GAPDH, β-actin)

  • Verify primer specificity through melting curve analysis and sequencing

Immunofluorescence/Immunohistochemistry:

  • Particularly useful for localizing Ptprr in tissue sections

  • Fixation protocol optimization is critical for maintaining epitope accessibility

  • Double-labeling with neuronal markers can help establish cell-type specific expression

How does Ptprr influence neuronal development and differentiation?

Ptprr plays significant roles in neuronal development through multiple mechanisms:

  • Regulation of Differentiation Timing: Ptprr expression significantly decreases after differentiation induction in enteric neural crest cells (ENCCs), suggesting its role in maintaining the undifferentiated state

  • Maintenance of Neural Precursor Pool: Experimental evidence indicates that Ptprr ensures a specific population of neural precursor cells by:

    • Inhibiting premature ENCC differentiation

    • Supporting ENCC proliferation as shown by increased EdU-positive immunofluorescence in Ptprr overexpression studies

  • Purkinje Cell Development: Ptprr expression is critical for proper cerebellar development, particularly in Purkinje cells where it regulates synaptic plasticity through LTD mechanisms

  • MAPK/ERK Regulation: By modulating GDNF-activated ERK1/2 signaling, Ptprr helps maintain the balance between differentiation and proliferation signals in developing neurons

Gene ontology data confirms Ptprr's involvement in both nervous system development and neuron differentiation, with experimental evidence from multiple model systems .

What phenotypic changes are observed in Ptprr knockout models?

Ptprr knockout (Ptprr^-/-) animals display several distinctive phenotypes:

Electrophysiological Abnormalities:

  • Impaired cerebellar long-term depression (LTD) in slice preparations

  • Failure to induce LTD when pairing parallel fiber stimulation with Purkinje cell depolarization

  • Quantitative analysis shows reduction of PF-EPSC after conditioning was significantly smaller in Ptprr^-/- PCs (1.6 ± 7.2%) compared to wild-type (28.3 ± 6.3%)

Molecular Alterations:

  • Elevated basal ERK1/2 phosphorylation levels

  • Absence of the normal increase in phosphorylated ERK1/2 associated with LTD induction

  • Normal GluA2-S880 phosphorylation under basal conditions but impaired response to LTD induction

Behavioral Phenotypes:

  • Impaired LTD in awake Ptprr^-/- mice

  • Altered responses in local field potential (LFP) recordings following conditioning stimulation

Developmental Changes:

  • Stunted development of enteric nervous system in fetal gut when Ptprr is knocked down

These phenotypes highlight Ptprr's critical role in neuronal signaling, particularly in processes requiring precise regulation of MAPK/ERK pathways.

What is the role of Ptprr in cerebellar long-term depression (LTD)?

Ptprr plays a crucial role in cerebellar LTD through its regulation of ERK1/2 signaling:

  • Baseline Conditions:

    • Ptprr maintains low basal ERK1/2 phosphorylation levels in Purkinje cells

    • This creates a responsive state for LTD-inducing stimuli

  • During LTD Induction:

    • In wild-type mice, LTD induction increases ERK1/2 phosphorylation

    • This ERK1/2 activation is necessary for AMPAR internalization and LTD expression

    • Ptprr^-/- mice fail to show this increase in phosphorylated ERK1/2

  • Functional Consequences:

    • When measuring excitatory postsynaptic currents (PF-EPSCs), pairing electrical stimulation of parallel fibers with Purkinje cell depolarization induces LTD in wild-type but not in Ptprr^-/- cerebellar slices

    • In vivo experiments show impaired LTD in awake Ptprr^-/- mice

    • Following conditioning protocols, wild-type mice show increased latencies of N2 and N3 peaks and decreased N3 amplitudes in local field potentials, while these effects are reduced in Ptprr^-/- mice

  • Specificity of Effect:

    • Basal synaptic transmission remains normal in Ptprr^-/- mice

    • Paired-pulse facilitation ratios are unaltered, indicating normal presynaptic function

    • AMPAR decay time constants are identical, suggesting normal AMPAR composition

This evidence suggests that Ptprr specifically facilitates LTD by establishing appropriate baseline conditions for the positive feedback loop involving ERK1/2 signaling.

What are the specific mechanisms by which Ptprr regulates the MAPK/ERK cascade in neuronal cells?

The molecular mechanisms of Ptprr's regulation of MAPK/ERK signaling in neuronal cells involve multiple levels of control:

  • Direct Enzymatic Dephosphorylation:

    • Ptprr directly dephosphorylates the activation loop (TXY motif) of ERK1/2

    • This dephosphorylation reduces ERK1/2 activity and downstream signaling

    • Experimental evidence shows elevated ERK1/2 phosphorylation in Ptprr^-/- models

  • Kinase Interaction Motif (KIM) Specificity:

    • Ptprr contains a kinase interaction motif that allows specific binding to MAPKs

    • This binding is regulated by phosphorylation of the KIM domain itself

    • The specificity of this interaction explains why Ptprr preferentially targets ERK1/2 rather than other signaling molecules

  • Compartmentalization of Signaling:

    • Different isoforms of Ptprr localize to different subcellular compartments

    • This compartmentalization allows for spatial regulation of ERK1/2 signaling

    • The transmembrane isoforms may respond to extracellular signals, while cytoplasmic isoforms regulate intracellular ERK activity

  • Integration with Growth Factor Signaling:

    • Ptprr modulates GDNF-activated ERK1/2 signaling

    • In Ptprr overexpression studies, GDNF-induced ERK1/2 activation is significantly decreased

    • This suggests that Ptprr acts as a feedback regulator of growth factor-induced MAPK signaling

Understanding these mechanisms requires sophisticated experimental approaches:

  • Phosphatase activity assays with purified proteins

  • Site-directed mutagenesis of key residues in both Ptprr and ERK1/2

  • Compartment-specific expression and knockdown studies

  • Advanced imaging techniques to visualize ERK activity in real-time

How does Ptprr contribute to the multipotency of enteric neural crest cells (ENCCs)?

Ptprr plays a sophisticated role in maintaining ENCC multipotency through several integrated mechanisms:

  • Temporal Expression Pattern:

    • Ptprr protein is predominantly expressed in the cytoplasm of undifferentiated ENCCs

    • Expression significantly decreases after differentiation induction

    • This pattern suggests Ptprr functions as an anti-differentiation factor

  • Regulation of Proliferation:

    • Genetic modulation studies show significantly increased EdU-positive immunofluorescence in Ptprr-overexpressing ENCCs

    • This indicates Ptprr promotes proliferation of neural precursor cells

    • Maintaining this proliferative capacity is essential for generating sufficient neural precursors

  • Resistance to Differentiation Signals:

    • ENCCs with Ptprr overexpression maintain undifferentiated patterns even when exposed to GDNF-mediated directional differentiation

    • This suggests Ptprr antagonizes differentiation signals

  • ERK1/2 Pathway Modulation:

    • GDNF-activated ERK1/2 expression is significantly decreased in Ptprr-overexpressing cells

    • The MAPK/ERK pathway is known to regulate the balance between differentiation and stemness

    • By regulating this pathway, Ptprr helps maintain the undifferentiated state of ENCCs

  • Developmental Consequences:

    • Ptprr knockdown in fetal gut results in stunted development of the enteric nervous system

    • This suggests that proper Ptprr expression is required for normal ENS development by ensuring an adequate pool of multipotent precursors

These findings collectively indicate that Ptprr's function in ENCCs is to ensure a sufficient population of neural precursor cells by inhibiting premature differentiation and maintaining proliferative capacity. This balance is critical for proper ENS development and function.

What methodological challenges exist in studying Ptprr phosphatase activity and how can they be addressed?

Studying Ptprr phosphatase activity presents several significant challenges:

  • Substrate Specificity Determination:

    • Challenge: Identifying physiological substrates beyond ERK1/2 is difficult due to transient enzyme-substrate interactions

    • Solution: Substrate-trapping mutants (e.g., C/S mutations in the catalytic site) can stabilize enzyme-substrate complexes for identification by mass spectrometry

    • Complementary approach: Proximity labeling techniques (BioID, APEX) coupled with proteomics to identify proteins in close proximity to Ptprr

  • Temporal Regulation of Activity:

    • Challenge: Ptprr activity likely fluctuates rapidly in response to signaling events

    • Solution: Development of real-time phosphatase activity sensors based on FRET technology

    • Application: These sensors would allow visualization of Ptprr activity in living cells with high temporal resolution

  • Isoform-Specific Functions:

    • Challenge: Multiple Ptprr isoforms exist with potentially different substrate preferences and subcellular localizations

    • Solution: Isoform-specific antibodies and genetic models (isoform-specific knockouts)

    • Approach: Subcellular fractionation followed by isoform-specific activity assays

  • In Vitro vs. In Vivo Activity:

    • Challenge: Phosphatase activity measured in vitro using artificial substrates may not reflect physiological activity

    • Solution: Development of cell-based assays that measure dephosphorylation of endogenous substrates

    • Validation: Correlation of in vitro activity measurements with in vivo phenotypes

  • Regulation by Post-Translational Modifications:

    • Challenge: Ptprr itself is regulated by phosphorylation and other modifications

    • Solution: Site-specific phosphorylation state antibodies and mass spectrometry-based phosphoproteomic approaches

    • Analysis: Correlation of Ptprr phosphorylation state with its catalytic activity and biological effects

  • Quantitative Activity Measurement:

    • Challenge: Traditional phosphatase assays using para-nitrophenylphosphate (pNPP) lack specificity

    • Solution: Phosphopeptide-based assays using physiologically relevant substrate sequences

    • Enhancement: Development of high-throughput screening methods for Ptprr activity modulators

Addressing these challenges requires integration of multiple approaches, including biochemical assays, advanced imaging techniques, proteomics, and genetic models, to build a comprehensive understanding of Ptprr's physiological functions.

How is Ptprr implicated in neurological disorders and disease models?

Ptprr's critical roles in neuronal signaling and development suggest potential implications in various neurological disorders:

  • Neurodevelopmental Disorders:

    • Hirschsprung Disease (HSCR): Downregulated PTPRR expression is associated with HSCR, a developmental disorder of the enteric nervous system

    • Research indicates that PTPRR gene downregulation is closely related to HSCR pathogenesis and may be involved in alterations in the enteric nervous system development

  • Cerebellar Dysfunction:

    • Ptprr's essential role in cerebellar LTD suggests potential involvement in motor learning disorders

    • Ptprr^-/- mice show impaired LTD both in cerebellar slices and in awake animals

    • These deficits might manifest as motor coordination and learning abnormalities

  • ERBB2 Signaling-Related Conditions:

    • Gene ontology data indicates Ptprr involvement in ERBB2 signaling pathway

    • ERBB2 dysregulation is implicated in various neurodevelopmental and neurodegenerative conditions

    • Ptprr may represent a regulatory node in these pathways

  • Neuronal Migration Disorders:

    • Ptprr's role in negative regulation of epithelial cell migration suggests potential involvement in neuronal migration disorders

    • Proper migration is essential for correct brain development and architecture

Understanding these disease connections requires:

  • Genetic association studies in patient populations

  • Detailed phenotypic characterization of Ptprr^-/- animal models

  • Cell-type specific and conditional knockout studies to dissect spatial and temporal requirements for Ptprr function

What are the latest methodological advances in generating and validating recombinant Ptprr for research applications?

Recent advances in producing and validating recombinant Ptprr include:

  • Expression System Optimization:

    • Mammalian expression systems (HEK293, CHO cells) preserve proper post-translational modifications

    • Baculovirus-insect cell systems balance higher yield with appropriate folding

    • Bacterial systems with specialized chaperones improve folding of difficult domains

  • Construct Design Strategies:

    • Domain-specific constructs (catalytic domain, extracellular domain, full-length)

    • Fusion tags that preserve native structure and activity (e.g., small, cleavable tags)

    • Introduction of stabilizing mutations identified through computational approaches

  • Purification Advances:

    • Tandem affinity purification strategies for increased purity

    • Size-exclusion chromatography coupled with multi-angle light scattering to confirm proper oligomeric state

    • Activity-based purification steps to enrich for functionally active protein

  • Validation Approaches:

    • Phosphatase activity assays using physiologically relevant substrates (phospho-ERK1/2)

    • Thermal shift assays to confirm proper folding and stability

    • Surface plasmon resonance to verify substrate binding

    • Western blot detection methods similar to those used for PTPRG

  • Structural Characterization:

    • Cryo-electron microscopy for full-length protein structure

    • X-ray crystallography for individual domains

    • Hydrogen-deuterium exchange mass spectrometry for dynamics and conformational studies

These methodological advances enable researchers to produce high-quality recombinant Ptprr that more accurately reflects the native protein's properties, facilitating more reliable experimental outcomes.

What are the emerging research directions for understanding Ptprr function?

Current evidence has established Ptprr's roles in ERK1/2 regulation, neural development, and synaptic plasticity, but several exciting research directions are emerging:

  • Single-Cell Analysis of Ptprr Function:

    • Application of single-cell transcriptomics and proteomics to understand cell-type specific roles

    • Correlation of Ptprr expression with cell state and differentiation potential

    • Spatial transcriptomics to map Ptprr expression patterns in complex tissues

  • Integration with Other Signaling Networks:

    • Exploration of crosstalk between Ptprr-regulated pathways and other signaling networks

    • Systems biology approaches to model Ptprr's position in broader signaling networks

    • Identification of feedback mechanisms that regulate Ptprr itself

  • Translational Applications:

    • Development of Ptprr modulators as potential therapeutic tools

    • Exploration of Ptprr as a biomarker for neural development disorders

    • Gene therapy approaches to correct Ptprr dysfunction in disease models

  • Advanced in vivo Models:

    • Conditional and inducible knockout models to dissect temporal requirements

    • Cell-type specific knockouts to understand tissue-specific functions

    • Humanized models to better translate findings to human physiology

  • Structural Biology Approaches:

    • Determination of full-length Ptprr structure

    • Analysis of conformational changes upon substrate binding

    • Structure-based design of specific inhibitors or activators

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.