Recombinant Rat Relaxin receptor 1 (Rxfp1)

Shipped with Ice Packs
In Stock

Description

Signaling Mechanisms

Recombinant rat RXFP1 exhibits complex activation dynamics:

PathwayMechanismOutcome
cAMPGαs coupling → AC activation → cAMP surge Vasodilation, anti-fibrosis
ERK1/2Gβγ-PI3K-PKCζ cascade Cell proliferation, survival
Nitric oxideeNOS/iNOS upregulation Vasorelaxation, angiogenesis

Unlike human RXFP1, rodent variants show limited response to small-molecule agonists like ML290 due to TM domain variations .

Cardiac Protection

AAV9-mediated RXFP1 overexpression in murine models:

  • Infarct size: Reduced by 42% (p < 0.01 vs controls)

  • Ejection fraction: Preserved at 58.3 ± 3.1% vs 42.7 ± 2.9% in untreated IR injury

Pharmacological Profiling

SA10SC-RLX, a lipidated peptide agonist:

  • EC₅₀: 0.4 nM on rat RXFP1-expressing HEK cells

  • In vivo half-life: >15 hr vs 4-6 hr for native relaxin

Comparative Species Analysis

FeatureRat RXFP1Human RXFP1
ML290 responseNo activation EC₅₀ = 1.2 μM
Relaxin-2 affinityKd = 0.8 nM Kd = 0.5 nM
Splice variants4 isoforms 6 isoforms

Therapeutic Implications

Gene therapy approaches using recombinant rat RXFP1 demonstrate:

  • Fibrosis reduction: 67% decrease in collagen deposition in renal models

  • Blood flow modulation: 35% increase in renal perfusion at 1 mg/kg SA10SC-RLX

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Rxfp1; Lgr7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-758
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MTSGPFFFCVFIIGRYFTLGNAQDVSCPLGSFPCGNISKCLPQLLHCNGVDDCGNQADED NCGDNNGWSLQLDKYFANYYKLTSTNSIEAETSECLVGSVPMHCLCRDLELDCDEANLRA VPSVSSNVTVMSLQWNFIRTLPPNSFRKYHDLQKLCLQNNKIRSVSVSAFRGLHSLTKLY LSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNALTRLPDK PLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINHLNEHAFTHLQKLDEL DLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDYLAKLKSLSLEGIEISNIQQ RMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAITC FGNIFVICMRPYIRSENKLHAMSIMSLCCADCLMGVYLFVIGAFDLKFRGEYRKHAQPWM ESVHCQFMGSLAVLSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRTVAVLIFIWITGF IVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGINLVAFIIIVFSYG SMFYSVHQSTITATEIQKQVKKEMILAKRFFFIVFTDALCWIPIFILKFLSLIRVEIPDT ITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWYNYRQRRSVDRKGTQKAYTPSFIW VEMWPLQEMSTEFMKPDAFTDPCDLSLVSRSSRLNSYS
Uniprot No.

Target Background

Function

Relaxin receptor 1 (RXFP1) is a G protein-coupled receptor mediating relaxin signaling. Ligand binding stimulates adenylate cyclase, increasing cAMP levels. Additionally, RXFP1 activation may trigger a tyrosine kinase pathway inhibiting cAMP-degrading phosphodiesterase.

Gene References Into Functions

Relevant Research:

  1. Testosterone treatment reduces knee passive range of motion and RXFP1/RXFP2 expression; this effect is antagonized by flutamide. PMID: 24642882
  2. Progesterone and estrogen upregulate RXFP1 & RXFP2, potentially contributing to increased knee laxity; testosterone downregulation may explain lower non-contact knee injury rates in males. PMID: 24465164
  3. RXFP1 is primarily located in uterine artery tunica media vascular smooth muscle cells, exhibiting peak expression during estrus and early pregnancy. PMID: 22744867
  4. H3 relaxin exerts antifibrotic effects via the RXFP1 receptor. PMID: 21229994
  5. RXFP1 expression in the myometrium is downregulated in late gestation, correlating with progesterone withdrawal. PMID: 20686183
  6. RXFP1 expression in uterine tissues is regulated during pregnancy; the fetal-placental unit plays a role in its regulation, with downregulation occurring in late gestation. PMID: 20686184
  7. RXFP1 forms a constitutively active signalosome, coupling to cAMP at sub-picomolar peptide concentrations. PMID: 20664520
  8. LGR7 is identified as the relaxin receptor in mice and rats. PMID: 15566402
  9. Mouse and rat LGR7 bind and are activated by relaxin ligands. PMID: 15956680
  10. LGR7-Truncate may regulate LGR7 signaling. PMID: 15956683
  11. LGR7 and LGR8 are upregulated in activated hepatic stellate cells and cirrhotic liver. PMID: 15956705
  12. High LGR7 mRNA expression is found in specific brain regions, including neocortex, hypothalamus, hippocampus, amygdala, and subfornical organ. PMID: 15956709
  13. LGR7 mRNA is expressed by neurons in various brain regions. PMID: 16725278
  14. LGR7 receptor derivatives affect relaxin-sensitive adenylate cyclase activity in a dose-dependent manner. PMID: 16776079
  15. Lgr7 and Lgr8 are upregulated in response to reduced uteroplacental blood flow in rats. PMID: 17524297
  16. RXFP1 (LGR7) is widely distributed in the male rat reproductive tract and may regulate spermatogenesis. PMID: 17623071
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Detected in brain cortex, and at low levels in testis.

Q&A

How is the extracellular domain of Rxfp1 organized, and what is its functional significance?

The extracellular portion of rat Rxfp1 has a hierarchical organization that contributes to its functional properties. It begins with an N-terminal LDLa domain, followed by a linker region connecting to the leucine-rich repeat domain (LRRD), which is then joined to transmembrane helix 1 through a hinge region. This complex arrangement facilitates a two-site binding model for the relaxin peptide: the LRRD serves as the primary high-affinity binding site, while a secondary low-affinity interaction occurs at the extracellular loops of the 7TM domain. Intriguingly, though the LDLa domain is not necessary for relaxin binding, it is absolutely essential for signal transduction. The LDLa domain's structural integrity is maintained by three cysteine bridges and a calcium ion binding site, highlighting the importance of this module for receptor activation. Mutations affecting these structural features can impair Rxfp1 function without necessarily disrupting relaxin binding .

What is known about species-specific variations in Rxfp1 structure?

Species-specific variations in Rxfp1 structure have significant implications for receptor function and ligand selectivity. While the genomic organization of Rxfp1 consists of 18 exons across mammalian species, there are notable sequence differences that affect receptor pharmacology. For instance, research comparing Rxfp1 from human, macaque, pig, guinea pig, and rabbit has revealed distinct activation patterns in response to relaxin peptides and small molecule agonists. The rabbit Rxfp1 stands out as particularly divergent, with unique substitutions in both the ectodomain and 7TM regions. Interestingly, the rabbit Rxfp1 responds to the small molecule agonist ML290 but fails to be activated by relaxin peptides from various species, including rabbit itself. These variations underscore the importance of selecting appropriate animal models for Rxfp1 research and highlight evolutionary adaptations in this receptor system .

What are the most effective strategies for expressing recombinant rat Rxfp1 in cell systems?

Expressing recombinant rat Rxfp1 in cell systems requires careful optimization of construct design and expression conditions. Based on experimental evidence, HEK293T cells have proven to be an effective expression system for Rxfp1. When designing expression constructs, researchers should consider incorporating epitope tags that facilitate detection and purification without compromising receptor function. N-terminal tags such as FLAG or HA have been successfully employed, though their positioning should be evaluated for potential effects on receptor activity. For enhanced expression and detection, fusion with fluorescent proteins like eGFP can be beneficial. Experimental data indicates that N-terminal eGFP fusion results in higher expression levels compared to C-terminal fusion. Additionally, strategic truncations of both N- and C-terminal regions can significantly improve expression yields. When transfecting cells, timing is crucial - functional assays are typically performed 24-48 hours post-transfection when receptor expression reaches optimal levels .

What signaling pathways are activated by rat Rxfp1, and how can they be measured?

Rat Rxfp1 activates multiple signaling pathways upon stimulation with relaxin, with the cAMP pathway being the most well-characterized. When transfected into various cell types, rat Rxfp1 responds to relaxin treatment by increasing intracellular cAMP production through G protein-mediated activation of adenylyl cyclase. Beyond cAMP, Rxfp1 activation also leads to increased phosphorylation of extracellular signal-regulated kinase 1/2 (ERK1/2), mitogen-activated protein kinase (MAPK), and various tyrosine kinases. Additionally, nitric oxide (NO) signaling has been observed in both transfected cells and cells endogenously expressing Rxfp1. For quantitative measurement of cAMP responses, homogeneous time-resolved fluorescence (HTRF) assays provide a sensitive method. In this approach, cells expressing Rxfp1 are stimulated with relaxin or other agonists, followed by detection of cAMP using fluorescently labeled anti-cAMP antibodies and cAMP-d2. The HTRF ratio (620 nm/665 nm) is measured and plotted against ligand concentration to generate dose-response curves. Alternative approaches include CRE-reporter assays, which utilize a reporter gene (e.g., β-galactosidase) under the control of a cAMP-responsive element to indirectly measure cAMP production .

How does the interaction between relaxin and rat Rxfp1 differ from other species?

The interaction between relaxin and Rxfp1 exhibits notable species-specific variations that are critical for researchers to consider. Experimental evidence from comparative studies reveals significant differences in how Rxfp1 from various species responds to relaxin peptides. While human, macaque, and pig Rxfp1 respond robustly to human relaxin treatment, the rabbit Rxfp1 shows a distinctive pattern. Despite being expressed on the cell surface, rabbit Rxfp1 fails to bind human relaxin in saturation binding assays and does not produce cAMP in response to relaxin peptides from human, mouse, pig, or even rabbit sources. This unusual characteristic of rabbit Rxfp1 suggests potential evolutionary adaptations or alternative signaling mechanisms. In contrast, guinea pig Rxfp1 responds to relaxin but shows limited activation by small molecule agonists like ML290. Interestingly, chimeric receptor studies combining domains from different species have demonstrated that the extracellular domain primarily determines relaxin binding specificity, while the 7TM domain influences responses to small molecule agonists. These species differences highlight the importance of selecting appropriate experimental models and considering evolutionary variations when interpreting Rxfp1 research findings .

What techniques can be used to assess ligand binding to rat Rxfp1?

Several complementary techniques can be employed to assess ligand binding to rat Rxfp1, each offering distinct advantages. Radioligand binding assays using 125I-labeled relaxin provide quantitative measurement of binding affinities and receptor densities. Alternatively, europium-labeled relaxin (Eu-RLN) offers a non-radioactive approach for saturation binding studies. In both cases, cells expressing Rxfp1 are incubated with labeled ligand, with or without competing unlabeled ligand, to determine specific binding parameters. Surface plasmon resonance (SPR) represents another powerful approach for studying relaxin-Rxfp1 interactions. For this technique, purified Rxfp1 constructs containing a biotinylated Avi-tag can be captured on streptavidin sensor chips, allowing real-time measurement of relaxin binding kinetics. Properly folded Rxfp1 constructs show concentration-dependent binding with nanomolar affinity (Kd ≈ 20 nM), while constructs lacking the extracellular domain fail to exhibit specific binding, confirming the importance of this region. For functional validation of ligand interactions, cAMP accumulation assays using HTRF or CRE-reporter systems provide evidence of receptor activation. When interpreting binding data, researchers should consider that some ligands may trigger signaling pathways other than cAMP production, potentially affecting results in indirect reporter assays .

How should researchers select appropriate controls for Rxfp1 experiments?

Designing rigorous controls for Rxfp1 experiments is essential for obtaining reliable and interpretable results. When conducting transfection experiments, empty vector controls should be included to account for endogenous responses in the chosen cell line. For pharmacological studies, forskolin serves as a valuable positive control, directly activating adenylyl cyclase independent of receptor activation. Experimental data typically normalizes cAMP responses as a percentage of the maximum forskolin response (10 μM), providing a reference for full activation. When testing novel ligands, established agonists like human relaxin should be included as reference compounds. For species comparison studies, relaxin peptides from multiple species should be tested in parallel to account for species-specific responses. When creating receptor constructs with modifications, the wild-type receptor should be processed in parallel to allow direct comparison of expression levels, ligand binding, and signaling properties. For binding assays, non-specific binding should be determined by including excess unlabeled ligand. When purifying recombinant Rxfp1, quality control should include size exclusion chromatography to assess monodispersity and thermal stability measurements to confirm proper folding. For chimeric receptor constructs, appropriate domain-swapped controls should be included to isolate the effects of specific receptor regions .

What are the key considerations for designing chimeric Rxfp1 constructs?

Designing chimeric Rxfp1 constructs represents a powerful approach for investigating domain-specific functions and species-specific properties. Based on experimental evidence, several critical considerations should guide this process. First, researchers must carefully select domain boundaries to preserve structural integrity - chimeric junctions are often best positioned within conserved regions to minimize disruption of protein folding. Second, maintaining the proper orientation and spacing of functional domains is crucial, as demonstrated by the complex interactions between the LDLa, LRRD, and 7TM domains in Rxfp1. Third, when swapping domains between species, researchers should consider evolutionary conservation - for example, the 7TM domain is generally more conserved than the extracellular regions, affecting the likelihood of obtaining functional chimeras. Fourth, expression systems must be optimized for each chimeric construct, as changes in primary sequence can significantly impact protein folding, trafficking, and stability. Published studies have successfully created rabbit-human and guinea pig-human Rxfp1 chimeras to identify regions responsible for ligand specificity, demonstrating that chimeras with human ectodomains and rabbit 7TM domains maintain relaxin responsiveness. Similarly, substituting portions of the guinea pig 7TM domain with human sequences partially restores small molecule activation, confirming the allosteric mode of action for different ligand types. These approaches can effectively dissect domain-specific functions while providing insights into the structural basis of species selectivity .

What are the most common pitfalls in Rxfp1 research and how can they be avoided?

Rxfp1 research presents several common pitfalls that researchers should proactively address. First, aggregation during purification significantly hampers structural and functional studies. This can be mitigated by optimizing construct design through strategic truncations of both N- and C-terminal regions, as evidenced by improved monodispersity in truncated constructs compared to full-length receptor. Second, species-specific variations in Rxfp1 pharmacology can lead to misleading interpretations when extrapolating between models. For instance, small molecule agonists like ML290 activate human but not mouse Rxfp1, while rabbit Rxfp1 responds to ML290 but not to relaxin peptides. Researchers should therefore validate receptor responses in their specific species of interest rather than assuming conserved pharmacology. Third, the complex multi-domain structure of Rxfp1 means that epitope tags or fusion proteins must be carefully positioned to avoid interfering with function. Experimental data shows that while N-terminal HA- or FLAG-tags combined with C-terminal tags slightly alter functional activity compared to wild-type Rxfp1, they still maintain responsiveness to relaxin stimulation. Fourth, different assay systems may yield apparently contradictory results due to activation of distinct signaling pathways. For example, at very high relaxin concentrations, rabbit Rxfp1 shows some activity in CRE-reporter assays but not in direct cAMP measurements, potentially reflecting activation of alternative signaling pathways. Using multiple complementary assays can provide a more complete picture of receptor function .

How can computational modeling enhance understanding of rat Rxfp1 structure and function?

Computational modeling offers powerful approaches for investigating rat Rxfp1 structure and function beyond what experimental techniques alone can achieve. Homology modeling represents a valuable starting point, utilizing the conserved nature of the 7TM domain to generate structural predictions based on crystallized GPCRs. These models can predict and visualize putative structural properties of Rxfp1 and guide rational design of different receptor constructs. Molecular dynamics simulations can further refine these models, providing insights into the dynamic behavior of different receptor domains and their interactions with ligands. For investigating the extracellular domains, the leucine-rich repeat structure lends itself to comparative modeling based on other LRR-containing proteins. Computational docking studies can predict binding modes for both peptide ligands like relaxin and small molecule agonists such as ML290, generating testable hypotheses about key interaction residues. Structure-based virtual screening campaigns can identify novel ligands targeting specific binding sites on Rxfp1. Machine learning approaches integrating experimental data with structural predictions can help identify patterns in structure-activity relationships. These computational methods become particularly powerful when integrated with experimental validation, creating an iterative process where predictions guide experiments and experimental results refine computational models .

What approaches can be used to study the pharmacology of allosteric modulators of rat Rxfp1?

Studying the pharmacology of allosteric modulators of rat Rxfp1 requires specialized approaches that can distinguish their effects from those of orthosteric ligands. Experimental evidence from studies with ML290, a small molecule agonist, provides insights into effective methodologies. Chimeric receptor studies represent a powerful approach, where domains from species with differential responses to allosteric modulators are swapped to identify critical regions. For example, substituting portions of the guinea pig 7TM domain with human sequences partially restores ML290 activation, confirming the allosteric mode of action. Radioligand binding studies with labeled relaxin in the presence and absence of potential allosteric modulators can detect cooperative effects on orthosteric ligand binding. Operational model analysis of concentration-response curves generated under different conditions can quantify allosteric parameters such as affinity and cooperativity. Biased signaling assays measuring multiple downstream pathways (cAMP, ERK1/2, β-arrestin recruitment) can identify pathway-selective allosteric modulators. Site-directed mutagenesis targeting predicted allosteric binding pockets can validate interaction sites and mechanism of action. For more complex analyses, time-resolved FRET-based conformational sensors can detect subtle changes in receptor conformation induced by allosteric modulators. Together, these approaches can comprehensively characterize the complex pharmacology of allosteric modulators targeting rat Rxfp1 .

What are emerging techniques for studying the in vivo function of rat Rxfp1?

Emerging techniques for studying the in vivo function of rat Rxfp1 combine genetic manipulation with advanced imaging and functional approaches. CRISPR/Cas9-mediated genome editing allows precise modification of the endogenous Rxfp1 gene to create knockouts, knock-ins of reporter genes, or specific mutations mirroring human variants. Cell-type specific conditional Rxfp1 knockout models using Cre-lox systems can dissect the receptor's role in different tissues without developmental compensation. For temporal control, inducible expression systems permit activation or suppression of Rxfp1 at specific developmental stages. In vivo optical imaging using fluorescent relaxin analogs can visualize receptor distribution and drug targeting in live animals. PET imaging with radiolabeled ligands offers another approach for non-invasive assessment of receptor occupancy and distribution. Fiber photometry and miniscope imaging in freely moving animals can correlate Rxfp1 activity with behavioral outputs through expression of calcium or cAMP sensors in Rxfp1-expressing cells. For functional assessment, sophisticated phenotyping platforms can detect subtle cardiovascular, renal, and reproductive effects of Rxfp1 manipulation. When selecting animal models, researchers should consider the species-specific differences in Rxfp1 pharmacology - for example, macaque and pig models respond to both relaxin and small molecule agonists like ML290, making them suitable for translational studies, while mouse models would be inappropriate for testing ML290 due to species-specific receptor variations .

How can researchers address low expression or functionality of recombinant rat Rxfp1?

Low expression or functionality of recombinant rat Rxfp1 presents a common challenge that can be addressed through several strategic approaches. First, optimizing codon usage for the expression system can significantly enhance translation efficiency. Second, incorporating well-designed signal sequences (such as human influenza hemagglutinin signal sequence) can improve membrane targeting. Third, strategic fusion with stability-enhancing proteins like eGFP can increase expression levels - experimental data demonstrates that N-terminal eGFP fusion produces better yields than C-terminal fusion. Fourth, exploring different expression systems beyond HEK293T cells may identify cell lines with more favorable post-translational processing for Rxfp1. Fifth, chemical chaperones or growth at reduced temperatures (30°C instead of 37°C) can improve folding of challenging membrane proteins. Sixth, specific truncations can dramatically improve expression - data shows that combined N-terminal (removing the LDLa domain) and C-terminal truncations increased protein yield three-fold compared to wild-type constructs. For functional assessment, ensuring calcium supplementation (2 mM CaCl₂) in assay buffers is critical, as the LDLa domain requires calcium for proper folding and function. If expression remains problematic, alternative approaches include creating stable cell lines with inducible expression systems or exploring insect cell or yeast expression platforms, which sometimes perform better for challenging GPCRs .

What strategies can resolve protein aggregation issues during Rxfp1 purification?

Protein aggregation during Rxfp1 purification represents a significant obstacle that can be addressed through multiple complementary strategies. Experimental evidence shows that construct design has profound effects on aggregation tendency - full-length and partially truncated Rxfp1 constructs predominantly elute as soluble aggregates, while combined N- and C-terminal truncations yield significantly improved monodispersity. Specifically, deletion of the first 89 amino acids and the last 50 amino acids produces monodisperse protein compared to the full-length receptor. Optimization of detergent selection is equally critical - mild detergents like DDM (n-dodecyl-β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) often preserve GPCR structure better than harsh detergents. Incorporation of cholesterol hemisuccinate or other lipids can stabilize the native conformation during extraction and purification. Temperature control during all purification steps helps minimize thermal denaturation, with procedures typically performed at 4°C. Addition of high-affinity ligands during solubilization and purification can lock the receptor in a more stable conformation. For quality assessment, fluorescence-detection size exclusion chromatography (F-SEC) effectively distinguishes monomeric receptor from aggregated forms, while nano-differential scanning fluorimetry (nanoDSF) can confirm proper protein folding through determination of melting temperatures. Properly folded Rxfp1 constructs should exhibit melting temperatures around 53°C, providing a quantitative measure of protein quality .

How can researchers interpret contradictory results from different Rxfp1 functional assays?

Interpreting contradictory results from different Rxfp1 functional assays requires careful consideration of the assays' underlying mechanisms and limitations. Experimental evidence shows that different assay formats can yield apparently discrepant results for the same receptor-ligand combination. For instance, rabbit Rxfp1 shows no response to relaxin in direct cAMP measurements using HTRF, but exhibits some activation at very high relaxin concentrations in indirect CRE-reporter assays. This discrepancy likely reflects activation of alternative signaling pathways that can indirectly influence CRE-dependent transcription. To resolve such contradictions, researchers should employ multiple complementary assays measuring different aspects of receptor function. Direct measurement of immediate signaling events (e.g., cAMP production via HTRF) provides the most straightforward assessment of canonical G-protein coupling. Binding assays can distinguish between binding and activation defects - for example, the inability of labeled human relaxin to bind rabbit Rxfp1 explains the lack of cAMP response despite receptor expression on the cell surface. Time-course experiments can reveal transient versus sustained signaling events that might be missed in endpoint assays. Dose-response relationships should be carefully examined, as some effects may only manifest at concentrations far exceeding physiological relevance. When interpreting results from chimeric receptors or mutated constructs, researchers should consider the possibility of altered signaling bias rather than complete loss of function. Integration of data from multiple assay formats, with careful consideration of their respective limitations, provides the most comprehensive picture of Rxfp1 function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.