Recombinant Rat RELT-like protein 2 (Rell2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, specific format requests should be noted during order placement to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please specify this during your order to allow for preferential development.
Synonyms
Rell2; RELT-like protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-302
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Rell2
Target Protein Sequence
MSEPQPGLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQ PPEDDDVNEDTVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSH HHTVHLGSAAPCIHCSRSKRPPLVRQGRSKEGKGRPRPGETTVFSVGRFRVTHIEKRYGL HEHRDGSPTDRSWGSGGGQEPGVSQVAGGQPRTGTAAIERLLPEPPPSQAAATHPVQNGR LKDASLVPCTLEGTPGTSAELNVGTRGTGPSPGLPSQEANGQPTKLDTSGQQDSLPPEAG GM
Uniprot No.

Target Background

Function

Overexpression of Recombinant Rat RELT-like protein 2 (Rell2) induces activation of the MAPK14/p38 cascade and apoptosis.

Database Links
Protein Families
RELT family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the molecular structure of rat Rell2 and how does it relate to other RELT family proteins?

Rat RELT-like protein 2 (Rell2) is a transmembrane protein belonging to the RELT family, which is related to the tumor necrosis factor receptor (TNFR) superfamily. The protein contains characteristic extracellular domains with conserved cysteine residues that form disulfide bonds critical for protein stability and function. Within the RELT family, Rell2 shares structural similarities with RELT (Receptor Expressed in Lymphoid Tissues) but has distinct functional domains that differentiate it from other family members . When working with recombinant forms of this protein, researchers typically express the extracellular domain with tags (such as His-tag) to facilitate purification while maintaining structural integrity, similar to the approach used with other recombinant rat proteins .

What are the known signaling pathways associated with rat Rell2?

Rat Rell2 participates in several critical cellular signaling pathways, primarily involving immune response regulation and cell survival mechanisms. Similar to other RELT family proteins, Rell2 likely interacts with intracellular signaling molecules that regulate NF-κB activation and subsequent gene expression. The protein has been implicated in apoptotic pathways through its interaction with death domain-containing proteins. Researchers investigating Rell2 signaling should consider examining both canonical and non-canonical NF-κB activation pathways, as well as potential cross-talk with other signaling cascades such as MAPK pathways . For comprehensive pathway analysis, techniques similar to those used in studying LRRK2 signaling can be adapted for Rell2 investigation .

What expression systems yield optimal results for recombinant rat Rell2 production?

The selection of an appropriate expression system for recombinant rat Rell2 depends on experimental requirements for protein folding, post-translational modifications, and yield. For functional studies requiring proper protein folding and glycosylation, mammalian expression systems (CHO or HEK293 cells) typically yield the most biologically active Rell2. For structural studies or applications requiring high protein yields, bacterial expression systems (E. coli) can be utilized with optimization of codon usage and inclusion of solubility tags. When using bacterial systems, researchers should employ approaches similar to those used for recombinant rat regenerating protein, where BamHI flanking sequences and T7 promoter-controlled expression vectors have shown success . For proper folding of disulfide bonds in E. coli, consider using specialized strains such as Origami or SHuffle.

What purification strategies are most effective for maintaining rat Rell2 bioactivity?

Purification of recombinant rat Rell2 requires careful consideration of protein stability and bioactivity. A multi-step approach typically yields best results:

  • Initial capture using affinity chromatography (if His-tagged, use Ni-NTA columns similar to protocols for rat Tie-2)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

Temperature management is critical throughout purification; maintain samples at 4°C whenever possible. Buffer optimization should include:

Buffer ComponentRecommended RangePurpose
pH7.0-7.5Stability optimization
NaCl150-300 mMPrevent aggregation
Glycerol5-10%Stabilization
Reducing agent0.5-1 mM DTT or 2-5 mM β-mercaptoethanolPrevent disulfide scrambling

For long-term storage, lyophilization or flash-freezing in buffer containing cryoprotectants (similar to protocols for rat IL-2) is recommended .

How should researchers design binding assays to study rat Rell2 interactions with potential ligands?

When designing binding assays for rat Rell2, researchers should employ multiple complementary approaches to validate interactions:

Surface Plasmon Resonance (SPR): Immobilize purified Rell2 on sensor chips using amine coupling chemistry. Determine association and dissociation rates by flowing potential ligands at various concentrations. Calculate affinity constants (KD) from kinetic data. Include positive controls (known binding partners) and negative controls (non-binding proteins of similar size).

Pull-down assays are also valuable, particularly when using His-tagged recombinant rat Rell2. Immobilize the protein on Ni-NTA resin and incubate with cell lysates or purified proteins to identify interaction partners. For membrane-associated interactions, consider biolayer interferometry as an alternative to SPR. When validating novel interactions, confirm results using co-immunoprecipitation from cells expressing rat Rell2 and the candidate binding partner .

What are the recommended protocols for studying rat Rell2's role in cell signaling pathways?

To elucidate rat Rell2's role in signaling pathways, researchers should implement a systematic approach:

  • Generate reporter cell lines: Develop stable cell lines expressing luciferase under control of response elements relevant to Rell2 signaling (NF-κB, AP-1)

  • Stimulation experiments: Treat cells with recombinant Rell2 at varying concentrations (1-100 ng/mL) and timepoints (15 min to 24 hours)

  • Phosphorylation analysis: Perform Western blots using phospho-specific antibodies against key signaling proteins (similar to approaches for studying LRRK2)

  • Inhibitor studies: Pre-treat cells with pathway-specific inhibitors to map the signaling cascade

For comprehensive pathway mapping, consider phosphoproteomics analysis of cells before and after stimulation with recombinant rat Rell2. This approach can identify novel phosphorylation events and unexpected pathway connections. Additionally, CRISPR/Cas9 knockout of individual signaling components can validate their requirement in Rell2-mediated signaling .

How does recombinant rat Rell2 influence immune cell function in experimental models?

Recombinant rat Rell2 shows significant immunomodulatory effects in experimental systems, particularly on T lymphocytes and antigen-presenting cells. To investigate these effects:

  • T cell proliferation assays: Culture purified T cells with varying concentrations of Rell2 (10-1000 ng/mL) in the presence of suboptimal anti-CD3 stimulation. Measure proliferation using [3H]-thymidine incorporation or CFSE dilution.

  • Cytokine production analysis: Determine the effect of Rell2 on cytokine production profiles using multiplex ELISA or cytometric bead arrays to measure IL-2, IFN-γ, TNF-α, and IL-10 .

  • Dendritic cell maturation: Assess the impact of Rell2 on expression of co-stimulatory molecules (CD80, CD86) and MHC class II on dendritic cells.

For in vivo studies, consider using immunodeficient rat models such as Sprague Dawley Rag2-null rats to evaluate the impact of Rell2 on immune reconstitution or specific immune cell populations . When designing these experiments, include appropriate controls such as heat-inactivated Rell2 and other recombinant proteins of similar size and structure.

What is known about rat Rell2's role in pathological states and how can researchers investigate this further?

Rat Rell2 has been implicated in several pathological processes including inflammatory conditions and cellular stress responses. To investigate its role in disease:

  • Expression analysis: Compare Rell2 expression levels in normal versus diseased tissues using qRT-PCR and immunohistochemistry.

  • Knockdown/overexpression studies: Use siRNA or CRISPR/Cas9 to modulate Rell2 expression in relevant cell types and assess the impact on disease-related phenotypes.

  • In vivo models: Administer recombinant rat Rell2 or neutralizing antibodies to animal models of inflammatory or autoimmune diseases.

For neurodegenerative disease studies, approaches similar to those used for LRRK2 in Parkinson's disease can be adapted for Rell2 research . This would include investigating potential neuroprotective or neurotoxic effects in primary neuronal cultures and analyzing Rell2 expression in affected brain regions. When using recombinant Rell2 in disease models, careful titration experiments should be performed to determine biologically relevant concentrations and potential dose-dependent effects.

How can researchers develop blocking antibodies against rat Rell2 for functional studies?

Developing effective blocking antibodies against rat Rell2 requires strategic immunization and screening approaches:

  • Antigen design: Identify functional domains in rat Rell2 likely involved in ligand binding or receptor multimerization. Express these domains as recombinant proteins for immunization.

  • Immunization strategy: Use diverse animal hosts (rabbits, hamsters, goats) to generate polyclonal antibodies. For monoclonal antibodies, immunize mice or rats with purified Rell2 domains.

  • Screening approach: Initially screen for binding using ELISA and Western blot. Subsequently perform functional assays to identify antibodies that block Rell2-mediated activities.

For epitope mapping, employ hydrogen-deuterium exchange mass spectrometry or peptide array technology to precisely identify binding sites. Once blocking antibodies are generated, validate their specificity using cells from Rell2 knockout animals as negative controls . When developing therapeutic antibodies, consider formats such as Fab fragments or single-chain variable fragments (scFvs) that may offer better tissue penetration.

What structural biology techniques are most informative for studying rat Rell2?

To elucidate the structural characteristics of rat Rell2, researchers should consider multiple complementary approaches:

  • X-ray crystallography: For high-resolution structure determination, optimize crystallization conditions using sparse matrix screens with purified Rell2 (potentially in complex with binding partners). Typical protein concentrations range from 5-15 mg/mL.

  • Cryo-electron microscopy: Particularly valuable for studying Rell2 complexes with other proteins or in membrane environments. This approach requires highly pure, homogeneous samples at concentrations of 1-5 mg/mL.

  • Nuclear Magnetic Resonance (NMR): Useful for studying protein dynamics and ligand interactions, especially for smaller domains of Rell2. Requires 15N or 13C-labeled protein.

For protein production aimed at structural studies, consider using carrier-free preparations similar to those recommended for recombinant rat Tie-2 . When designing constructs for structural studies, analyze domain boundaries carefully using bioinformatics tools to ensure proper protein folding. Surface entropy reduction mutations might facilitate crystallization of recalcitrant domains.

What are the most common issues in recombinant rat Rell2 expression and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant rat Rell2:

  • Low expression yields: Optimize codon usage for the expression host. Consider fusion tags (SUMO, MBP) that enhance solubility. Test multiple promoter systems to identify optimal expression conditions.

  • Protein misfolding: Express protein at lower temperatures (16-18°C) to slow folding and prevent aggregation. Include chemical chaperones (glycerol, arginine) in the culture medium.

  • Proteolytic degradation: Add protease inhibitors during purification. Identify and mutate protease-sensitive sites without affecting protein function.

For expression in mammalian systems, test different cell lines (HEK293, CHO, COS-7) as expression efficiency can vary significantly. When using E. coli, consider specialized strains designed for disulfide bond formation, similar to approaches used for other recombinant rat proteins . For persistent solubility issues, refolding from inclusion bodies can be attempted using gradual dialysis against decreasing concentrations of denaturants.

What quality control measures should be implemented for recombinant rat Rell2 prior to functional studies?

Comprehensive quality control is essential for ensuring reliable results in functional studies with recombinant rat Rell2:

Quality ParameterMethodAcceptance Criteria
PuritySDS-PAGE, Size Exclusion Chromatography>95% purity
IdentityMass Spectrometry, Western BlotCorrect molecular weight, positive antibody recognition
Endotoxin ContentLAL Chromogenic Assay≤0.1 ng per μg protein (similar to IL-2 standards)
Biological ActivityCell-based functional assayEC50 within 3-fold of reference standard
Aggregation StatusDynamic Light Scattering>90% monodisperse

For recombinant proteins intended for in vivo use, additional sterility testing is required. Storage stability should be assessed under various conditions (temperature, freeze-thaw cycles) to establish appropriate handling guidelines. When using recombinant Rell2 as a reference standard in assays, consider aliquoting into single-use portions to avoid repeated freeze-thaw cycles that can compromise activity .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.