Recombinant Rat Reticulon-1 (Rtn1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rtn1; Nsp; Reticulon-1; Neuroendocrine-specific protein; S-rex
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-777
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MAAPPDLQDEPLSPANPGSQLFGGRGEGEEATPKGARPAQQDGEPAWGSGAGAGVVSSRG LCSGPARSPPVAMETASTGVAAVPDALDHSSSPTLKDGEGACYTSLISDICYPPREDSAY FTGILQKENGHITTSESPEELGTPGPSLPEVPGTEPHGLLSSDSGIEMTPAESTEVNKIL ADPLDQMKAEACKYIDITRPQEAKGQEEQSPGLEDKDLDFKDKDSEVSTKPEGVHAPNQP SPVEGKLIKDNLFEESTFAPYIDELSDEQHRMSLVTAPVKITLTEIGPPVMTATHETIPE KQDLCLKPSPDTVPTVTVSEPEDDSPGSVTPPSSGTEPSAAESQGKGSVSEDELIAAIKE AKGLSYETTESPRPVGQAADRPKVKARSGLPTIPSSLDQEASSAESGDSEIELVSEDPMA SEDALPSGYVSFGHVSGPPPSPASPSIQYSILREEREAELDSELIIESCDASSASEESPK REQDSPPMKPGVLDAIREETSSRATEERAPSHQGPVEPDPILSFTPVTLQSRPEPSSGDG APVPEPPKSQQQKPEEEAVSSSQSPAATEIPGPLGSDLVPPLPFFNKQKAIDLLYWRDIK QTGIVFGSFLLLLFSLTQFSVVSVVAYLALAALSATISFRIYKSVLQAVQKTDEGHPFKA YLELEITLSQEQIQKYTDCLQLYVNSTLKELRRLFLVQDLVDSLKFAVLMWLLTYVGALF NGLTLLLMAVVSMFTLPVVYVKHQAQVDQYLGLVRTHINTVVAKIQAKIPGAKRHAE
Uniprot No.

Target Background

Function
Inhibits amyloid precursor protein processing, likely by blocking BACE1 activity.
Gene References Into Functions
  1. These data suggest that RTN1-C may be a novel therapeutic candidate for cerebral ischemia/reperfusion injury. PMID: 28981095
  2. This study identified ryanodine receptor 2, an intracellular calcium release channel, as a direct binding partner of RTN1A. PMID: 23454728
  3. Neuroendocrine-specific protein-A (NSP-A) was identified as an ethanol-responsive gene in the fetal rat brain. PMID: 12354640
Database Links

KEGG: rno:116644

UniGene: Rn.55126

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed predominantly in central and peripheral nervous system of newborn and adult rats. Low levels have been also detected in heart, adrenal gland and spleen. Expression of isoform RTN1-B is restricted to particular neuronal types.

Q&A

What is Reticulon-1 and what are its major isoforms in rats?

Reticulon-1 (Rtn1), also known as neuroendocrine-specific protein, belongs to the reticulon (RTN) family of membrane-bound proteins that predominantly localize to the endoplasmic reticulum (ER). All RTN family members share a conserved reticulon homology domain (RHD) and are involved in shaping the tubular endoplasmic reticulum network . In rats, Rtn1 exists in multiple isoforms, with the most studied being Rtn1-A (84 kDa) and Rtn1-C (23-24 kDa). These isoforms have distinct tissue expression patterns and potentially different functions in neuronal development and maintenance . The Rtn1-C isoform has been particularly well-characterized in the context of neuronal development and axonal functions.

What is the structural organization of Rat Reticulon-1?

Rat Reticulon-1 contains several key structural features that define its function and localization:

  • A conserved reticulon homology domain (RHD) at the C-terminus

  • Four putative membrane-spanning domains that form hairpin-like structures

  • An ER membrane retention signal that ensures proper cellular localization

  • N-terminal regions that differ between isoforms, accounting for their size differences

The topology of Rtn1 is characterized by both N and C termini facing the cytoplasm, while the membrane-spanning segments insert into the ER membrane but do not cross the lipid bilayer completely. This unique insertion pattern creates membrane curvature, which contributes to the tubular structure of the ER .

What is the recommended storage and reconstitution protocol for recombinant Rat Rtn1?

For optimal stability and activity of recombinant Rat Reticulon-1:

Storage Conditions:

  • Lyophilized form: Stable for 12 months at -20°C or -80°C

  • Liquid form: Stable for 6 months at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles that can compromise protein integrity

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

  • Aliquot to minimize freeze-thaw cycles

  • For working solutions, store aliquots at 4°C for up to one week

This protocol ensures maximum stability and activity of the recombinant protein for experimental applications.

How can I validate the activity and specificity of recombinant Rat Rtn1 in neuronal culture experiments?

A comprehensive validation approach should include multiple methods:

Western Blot Validation:

  • Use well-characterized antibodies (e.g., RTN1 antibody 15048-1-AP) with recommended dilutions of 1:500-1:4000

  • Confirm the expected molecular weight (23 kDa for Rtn1-C; 84 kDa for Rtn1-A)

  • Include positive controls from rat brain tissue where Rtn1 is highly expressed

Immunofluorescence Validation:

  • Perform co-localization studies with ER markers (e.g., calnexin, KDEL)

  • Visualize distribution in neurites of primary neurons from rat cortical or hippocampal cultures

  • Compare patterns with published literature on RTN1 localization

Functional Validation:

  • Assess ER morphology using fluorescent markers or electron microscopy

  • Examine microtubule dynamics using live cell imaging with EB3-GFP to track comet movement

  • Measure parameters like microtubule growth rate, comet track length, and lifetime before and after Rtn1 application or knockdown

This multi-modal validation strategy ensures both protein identity and biological activity are properly characterized before proceeding with more complex experiments.

What are the recommended approaches for Rtn1 knockdown in neuronal axons?

Based on research with cortical neurons, effective Rtn1 knockdown in axons can be achieved through:

Compartmentalized Microfluidic Chamber Method:

  • Culture neurons in microfluidic devices that separate cell bodies from axonal compartments

  • Apply siRNA specifically to the axonal compartment to achieve local knockdown

  • Use scrambled siRNA controls in parallel chambers

  • Confirm knockdown efficiency through immunofluorescence or RT-qPCR from isolated axonal material

Key Parameters for Successful Axonal Rtn1 Knockdown:

ParameterRecommended ValueNotes
Neuron age10 DIV (days in vitro)Mature enough for axonal targeting
siRNA concentration50-100 nMOptimize for each preparation
Transfection duration24-48 hoursMonitor for toxicity
Positive controlsAxonal protein markersβ-actin, β-tubulin
Negative controlsScrambled siRNAMust match GC content of target siRNA

Local knockdown specifically in the axonal compartment has been shown to enhance outgrowth and reduce distal tubulin levels in injured cortical axons, while also restoring microtubule growth rate and length following injury .

How does Rtn1 interact with microtubule dynamics in axonal regeneration?

Recent research has revealed complex interactions between Rtn1 and the microtubule cytoskeleton that impact axonal regeneration:

Key Experimental Findings:

  • Following axonal injury, local synthesis of Rtn1-C increases in the distal axon segment

  • Rtn1-C associates with Spastin, a microtubule-severing protein, inhibiting its activity

  • Knockdown of axonal Rtn1 enhances axonal outgrowth following injury by:

    • Increasing microtubule growth rate from 0.08 μm/s to 0.12 μm/s

    • Extending comet track length from approximately 2 μm to 3.5 μm

    • These effects are partially dependent on Spastin activity

Experimental Evidence for Rtn1-Microtubule Interaction:

ParameterControl AxonsInjured AxonsInjured + Rtn1 KDStatistical Significance
Microtubule growth rate~0.10 μm/s~0.08 μm/s~0.12 μm/sp<0.05
Comet track length~3.0 μm~2.0 μm~3.5 μmp<0.05
Comet lifetime~10 s~10 s~10 sNot significant

This data demonstrates that axonal Rtn1 synthesis governs microtubule growth rate and comet track length in injured axons, with implications for regenerative capacity. Importantly, inhibition of Spastin with specific inhibitors prevents the enhanced outgrowth effects of Rtn1 knockdown, indicating a functional interaction between these proteins .

What are the methodological considerations for studying Rtn1 localization in subcellular compartments?

Investigating the precise localization of Rtn1 across subcellular compartments requires specialized techniques:

Subcellular Fractionation Protocol:

  • Homogenize tissue/cells in isotonic buffer with protease inhibitors

  • Perform differential centrifugation to isolate:

    • Nuclear fraction (600g pellet)

    • Heavy membrane fraction containing ER and lysosomes (10,000g pellet)

    • Light membrane fraction (100,000g pellet)

    • Cytosolic fraction (100,000g supernatant)

    • Polysomal fraction (through sucrose gradient ultracentrifugation)

  • Validate fraction purity using markers:

    • ER: Calnexin, PDI

    • Nuclear: Lamin B, Histone H3

    • Polysomal: RPL26, RPS6

  • Perform Western blotting to detect Rtn1 distribution

Immunofluorescence Microscopy Optimization:

  • Test multiple fixation methods (4% PFA, methanol, or combinations)

  • Try various permeabilization protocols (0.1-0.5% Triton X-100, saponin, digitonin)

  • Use co-localization with established markers:

    • ER tubules: Sec61β, RTN4/NogoA

    • ER sheets: Climp63

    • Neurite granules: Staufen1, FMRP

Studies in Xenopus have shown that XRTN1-C protein localizes to both the ER and in granules in neurites of primary neurons, and is detected in heavy membrane fractions containing ER-resident proteins, as well as in nuclear and polysomal fractions . This suggests multiple functional roles across different cellular compartments.

How can I address issues with Rtn1 solubility and stability in experimental buffers?

Recombinant Rtn1 contains membrane-spanning domains that can create solubility challenges. Here's a methodological approach to optimize buffers for various applications:

Solubility Enhancement Strategies:

Buffer ComponentRecommended RangePurpose
Glycerol5-50%Prevents aggregation, enhances stability
Mild detergents0.01-0.1% Triton X-100 or NP-40Solubilizes hydrophobic regions
Reducing agents1-5 mM DTT or 2 mM glutathionePrevents disulfide bond formation
Salt concentration100-300 mM NaClReduces ionic interactions
pH range7.0-8.0Maintains native structure

Stability Testing Protocol:

  • Prepare protein in various buffer conditions

  • Aliquot and store at different temperatures (-80°C, -20°C, 4°C)

  • Test activity/integrity at regular intervals (0, 1, 2, 4, 8, 12 weeks)

  • Analyze by SDS-PAGE, Western blotting, and functional assays

For applications requiring shipping or temporary storage, it's recommended to maintain the protein in either lyophilized form or in solution with 50% glycerol at -20°C/-80°C . Repeated freeze-thaw cycles should be avoided by preparing single-use aliquots.

What are the key considerations when interpreting contradictory results in Rtn1 functional studies?

When faced with divergent findings in Rtn1 research, consider these methodological factors that could explain discrepancies:

Isoform-Specific Effects:

  • Verify which Rtn1 isoform was used (Rtn1-A, Rtn1-C, or partial constructs)

  • Different isoforms may have distinct or even opposing functions

  • Check for the presence of tags that might interfere with function

Cell/Tissue Type Variations:

  • Rtn1 functions differently in various neural cell types

  • Compare results between primary cultures and cell lines

  • Note developmental stage differences (embryonic vs. adult neurons)

Experimental Context Considerations:

  • Injured vs. healthy neurons show different responses to Rtn1 manipulation

  • Axonal vs. somatic knockdown may produce opposite effects

  • Local vs. global protein synthesis can influence outcomes

Systematic Troubleshooting Approach:

  • Reproduce key experiments with careful attention to isoform, source, and concentration

  • Include positive and negative controls for each experimental system

  • Validate antibody specificity with knockout/knockdown controls

  • Consider temporal dynamics (acute vs. chronic manipulations)

  • Analyze multiple functional readouts rather than relying on a single assay

For example, research has shown that while Rtn1-C locally synthesized in injured axons inhibits regeneration through Spastin interaction, the same protein may have different effects in cell bodies or during development, illustrating the context-dependent nature of Rtn1 function .

What are promising research directions for understanding Rtn1's role in neurological disorders?

Emerging evidence suggests several productive avenues for investigating Rtn1 in neurological conditions:

Neurodegenerative Disease Connections:

  • Analyze Rtn1 expression and localization in animal models of Alzheimer's, Parkinson's, and ALS

  • Investigate interactions between Rtn1 and disease-associated proteins (e.g., Tau, α-synuclein)

  • Test whether Rtn1 modulation can mitigate ER stress, a common feature in neurodegeneration

  • Examine genetic associations between RTN1 variants and disease risk or progression

Axonal Injury and Regeneration Mechanisms:

  • Develop targeted approaches to modulate Rtn1-C in injured CNS axons in vivo

  • Map the complete interactome of Rtn1 in injured vs. healthy axons

  • Determine if Rtn1's effects on microtubule dynamics extend to other regeneration-limiting contexts

  • Test combinatorial approaches targeting both Rtn1 and other regeneration-associated pathways

Methodological Innovations:

  • Generate conditional knockout models for temporal and spatial control of Rtn1 expression

  • Develop Rtn1 isoform-specific antibodies and biosensors for live imaging

  • Apply advanced microscopy techniques (STORM, PALM) to visualize Rtn1-mediated ER remodeling

  • Utilize proteomics approaches to identify post-translational modifications regulating Rtn1 function

These research directions may ultimately lead to therapeutic strategies for enhancing neural repair following injury or in degenerative conditions by targeting Rtn1 and its associated pathways.

How might advanced genomic and proteomic approaches enhance our understanding of Rtn1 regulation?

Next-generation methodologies offer powerful tools for dissecting the complex regulation of Rtn1:

Transcriptomic Approaches:

  • Single-cell RNA sequencing to identify cell-type-specific Rtn1 isoform expression patterns

  • CLIP-seq to map RNA-binding proteins that regulate Rtn1 mRNA localization and translation

  • Ribosome profiling of isolated axons to quantify local translation dynamics of Rtn1 isoforms

  • RNA structure analysis to identify regulatory elements affecting Rtn1 mRNA stability and translation

Proteomic Strategies:

  • BioID or APEX2 proximity labeling to map the Rtn1 interactome at the ER membrane

  • Quantitative phosphoproteomics to identify signaling pathways regulating Rtn1 function

  • Crosslinking mass spectrometry to determine structural interactions within Rtn1 complexes

  • Pulse-chase proteomics to measure Rtn1 turnover rates in different subcellular compartments

Integrative Multi-Omics Framework:

ApproachTechnical PlatformExpected Insights
Spatial transcriptomicsVisium, MERFISHRegional expression patterns in brain tissue
Isoform-specific proteomicsMS-based targeted proteomicsQuantification of specific Rtn1 variants
Interactome mappingIP-MS, BioIDContext-dependent protein interactions
Epigenetic regulationChIP-seq, ATAC-seqTranscriptional control mechanisms
Post-translational modificationsMS/MS analysisRegulatory sites affecting function

These integrated approaches would provide a systems-level understanding of how Rtn1 expression and function are regulated across different neural cell types, developmental stages, and disease contexts, potentially revealing new therapeutic targets for neurological conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.