Recombinant Rat Reticulon-4 receptor-like 1 (Rtn4rl1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
Rtn4rl1; Ngrh2; Reticulon-4 receptor-like 1; Nogo receptor-like 2; Nogo-66 receptor homolog 2; Nogo-66 receptor-related protein 3; NgR3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-424
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Rtn4rl1
Target Protein Sequence
CPRDCVCYPSPMTVSCQAHNFAAIPEGIPEDSERIFLQNNHITFLQQGHFSPAMVTLWIY SNNITFIAPNTFEGFVHLEELDLGDNRQLRTLAPETFQGLVKLHALYLYKCGLSSLPAGI FGGLHSLQYLYLQDNHIEYLQDDIFVDLVNLSHLFLHGNKLWSLGQGIFRGLVNLDRLLL HENQLQWVHHKAFHDLHRLTTLFLFNNSLTELQGDCLAPLVALEFLRLNGNAWDCGCRAR SLWEWLRRFRGSSSVVPCATPELRQGQDLKSLRVEDFRNCTGPASPHQIKSHTLSTSDRA ARKEHHPSHGASRDKGHPHGHLPGSRSGSKKPGKNCTSHRNRNQISKGSAGKELPELQDY APDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQAS
Uniprot No.

Target Background

Function

Reticulon-4 receptor-like 1 (Rtn4rl1) is a cell surface receptor with functionally redundant roles in postnatal brain development and adult central nervous system axon regeneration. It contributes to normal axon migration across the brain midline and corpus callosum formation. Rtn4rl1 protects motoneurons from apoptosis, likely mediated by myelin-associated glycoprotein (MAG). It inhibits neurite outgrowth and axon regeneration by binding to neuronal chondroitin sulfate proteoglycans. It also binds heparin and, like other family members, regulates dendritic spine and synapse formation during brain development. Its signaling activates Rho, leading to actin cytoskeleton reorganization.

Gene References Into Functions
  1. The spatiotemporal expression patterns of NgR1, NgR2, and NgR3 mRNAs and proteins in the developing olfactory system suggest a role for NgR1 and its homologs in axon outgrowth under non-pathological conditions. PMID: 19063867
Database Links
Protein Families
Nogo receptor family
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft. Perikaryon. Cell projection.
Tissue Specificity
Detected in brain (at protein level). Expressed in various regions of the brain, including the cerebral cortex, hippocampus, striatum, thalamus and cerebellum.

Q&A

What physiological functions have been attributed to Rtn4rl1 in the nervous system?

Rtn4rl1, as part of the reticulon-4 receptor family, was initially characterized as a neuronal NoGo receptor involved in suppressing axonal growth induced by 'NoGo' proteins . While traditionally viewed as inhibitors of neuronal regeneration, recent research has expanded our understanding of their physiological roles.

A significant breakthrough came with the discovery that RTN4-receptors function as high-affinity ligands for BAI (brain-specific angiogenesis inhibitor) adhesion-GPCRs . This interaction occurs with nanomolar affinity and suggests Rtn4rl1 plays roles beyond simple inhibition of axonal growth. The BAI3-RTN4R interaction exhibits particularly high affinity (Kd = 1.9 nM), indicating a strong biological relevance .

How does Rtn4rl1 differ from other members of the reticulon-4 receptor family?

Rtn4rl1 (also known as NgR3) is one of three identified members of the reticulon-4 receptor family, which also includes RTN4R (NgR1) and RTN4RL2 (NgR2). These receptors share structural similarities but differ in several key aspects:

FeatureRtn4rl1 (NgR3)RTN4R (NgR1)RTN4RL2 (NgR2)
Binding to BAI1Nanomolar affinityHighest affinity (Kd = 1.9 nM for BAI3)Lowest affinity (Kd = 30.0 nM for BAI1)
SynonymsNgrh2, NoGo-66 receptor homolog 2NoGo receptorNoGo receptor-like 2
Key binding interfacesLRR domainLRR domainLRR domain

The differential binding properties suggest that despite structural similarities, these receptors might have distinct physiological functions or might be activated under different contexts in vivo. Their expression patterns may also differ across brain regions and developmental stages, though the search results don't provide specific details on this aspect.

What are the optimal storage and handling conditions for recombinant Rtn4rl1 proteins?

Proper storage and handling of recombinant Rtn4rl1 is crucial for maintaining protein activity. Based on manufacturer recommendations, the following protocols should be followed:

Storage ConditionRecommendation
Long-term storage-20°C/-80°C, with aliquoting necessary for multiple use
Short-term/working storage4°C for up to one week
Physical formLyophilized powder
Storage bufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Freeze-thaw cyclesAvoid repeated freeze-thaw cycles

For reconstitution of lyophilized Rtn4rl1:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

  • Aliquot for long-term storage at -20°C/-80°C

These storage conditions help maintain protein stability and activity. The addition of glycerol as a cryoprotectant is particularly important for preventing damage during freezing. The high purity (>90% as determined by SDS-PAGE) of commercial recombinant proteins should be maintained through proper handling .

What expression systems are most effective for producing recombinant Rtn4rl1?

Multiple expression systems have been successfully employed for recombinant Rtn4rl1 production, each with distinct advantages:

Expression SystemCharacteristicsApplications
E. coliHigh yield, economical, limited post-translational modificationsStructural studies, antibody production
YeastModerate yield, eukaryotic modifications, economicalStudies requiring glycosylation
Mammalian cellsLow-to-moderate yield, native-like modifications, expensiveFunctional studies requiring authentic structure

E. coli expression has been successfully used for producing recombinant rat Rtn4rl1 with N-terminal His tags (residues 25-424) . This system is particularly suitable for structural studies where high protein yields are required.

The yeast expression system offers a balance between yield and post-translational modifications, described as "the most economical and efficient eukaryotic system for secretion and intracellular expression" . This system allows for modifications such as glycosylation, which may be important for Rtn4rl1 function.

For studies focusing on protein interactions where post-translational modifications are critical (particularly O-fucosylation and C-mannosylation), mammalian expression systems may be preferable despite their higher cost and lower yield . The choice of expression system should align with the specific research questions being addressed.

How do post-translational modifications affect Rtn4rl1 binding interactions?

Post-translational modifications play a crucial role in mediating Rtn4rl1 interactions with binding partners. Crystallographic analysis of the BAI1/RTN4-receptor complex has revealed that glycosylation creates an unusual binding interface essential for high-affinity interactions .

Two key modifications have been identified:

  • O-fucosylation of threonine: The crystal structure revealed an O-linked glucose-β−1,3-fucose modification on Thr424 that forms water-mediated intramolecular hydrogen bonds, restricting sugar flexibility. Mutational studies demonstrated that the Thr424Val mutation, which blocks O-fucosylation, completely abolished binding to RTN4R, highlighting this modification's essential role .

  • C-mannosylation of tryptophan: The Trp418Phe mutation produced a partial decrease in RTN4R binding, indicating that this residue and its potential C-mannosylation contribute to binding affinity, though perhaps to a lesser extent than O-fucosylation .

These findings demonstrate that post-translational modifications are not merely decorative but form an integral part of the binding interface between Rtn4rl1 and its partners. Research investigating Rtn4rl1 interactions should consider expression systems that can produce these critical modifications for authentic binding behavior .

What experimental approaches can resolve contradictory data regarding Rtn4rl1 binding partners?

When facing contradictory findings about Rtn4rl1 binding partners, a multi-method validation strategy is essential for resolving discrepancies. The following approaches have proven successful:

  • Unbiased interaction discovery methods: Researchers used unbiased approaches that led to the unexpected discovery of high-affinity interactions between RTN4-receptors and BAI adhesion-GPCRs . This demonstrates the value of hypothesis-free screening techniques for identifying novel interactions.

  • Quantitative binding assays: Surface plasmon resonance (SPR) with purified recombinant proteins provides rigorous quantitative measurements of binding affinities. The BAI3-RTN4R interaction exhibited the highest affinity (Kd = 1.9 nM), while the BAI1-RTN4RL2 interaction displayed the lowest affinity that was still nanomolar (Kd = 30.0 nM) .

  • Domain mapping through truncation experiments: By generating a series of domain truncations of BAI1 and BAI3, researchers identified specific binding regions. For example, the single TSR3 domain of BAI1 bound robustly to RTN4Rs, narrowing down the interaction interface .

  • Structural validation: X-ray crystallography at high resolution (1.65 Å) provided definitive evidence of the binding interface between the RTN4R LRR domain and the BAI1 TSR3 domain .

  • Mutational analysis of key residues: Site-directed mutagenesis of interface residues identified from structural studies (e.g., Arg430Ala, His210Ala, Tyr254Ala) abolished complex formation, confirming their importance in the interaction .

This integrated approach combining multiple orthogonal methods provides robust evidence to resolve contradictory findings and establish authentic binding partnerships.

How does the leucine-rich repeat domain of Rtn4rl1 contribute to its interaction specificity?

The leucine-rich repeat (LRR) domain is the primary mediator of Rtn4rl1's interaction specificity. Structural and functional studies have revealed several key features of this domain:

These features collectively enable the LRR domain to discriminate between potential binding partners with high specificity, allowing for precise control of Rtn4rl1-mediated signaling pathways.

What are the key considerations for designing antibody-based detection methods for Rtn4rl1?

Developing effective antibody-based detection methods for Rtn4rl1 requires careful consideration of several factors:

  • Antibody specificity and validation: Commercial antibodies against Rtn4rl1 are available with reactivity to mouse and rat species. When selecting antibodies, prioritize those with validation data in specific applications relevant to your experiments .

  • Application-specific optimization:

ApplicationRecommended DilutionSpecial Considerations
Western Blotting (WB)1:1000-1:4000Validated as primary application for most antibodies
Immunohistochemistry (IHC)Application-specificSome antibodies work with both paraffin-embedded and frozen sections
Immunofluorescence (IF)Application-specificMay require optimization for cell culture (cc) vs. tissue (p) samples
  • Antibody format and storage: Anti-Rtn4rl1 antibodies are typically supplied as IgG in PBS with 0.02% sodium azide and 50% glycerol at pH 7.2. Store at -20°C for long-term (one year) storage and at 4°C for short-term use (up to one month). Avoid repeated freeze-thaw cycles .

  • Host species considerations: Rabbit-hosted polyclonal antibodies are commonly used for Rtn4rl1 detection. Consider potential cross-reactivity issues when designing multi-label experiments .

  • Molecular weight verification: When performing Western blotting, confirm detection at the expected molecular weight of approximately 49 kDa for Rtn4rl1 .

Following these considerations will help ensure specific and reliable detection of Rtn4rl1 in various experimental contexts.

What crystallography techniques have been successful for studying Rtn4rl1-ligand complexes?

High-resolution structural information on Rtn4rl1-ligand complexes has been obtained through X-ray crystallography using several key techniques:

  • Domain-focused crystallization: Rather than attempting to crystallize full-length proteins, researchers successfully crystallized the leucine-rich repeat (LRR) domain of mouse RTN4R (residues 27–310) in complex with the mouse BAI1 TSR3 domain. This domain-specific approach likely improved crystallization by removing flexible regions that could hinder crystal formation .

  • Co-crystallization with binding partners: The RTN4R LRR domain was co-crystallized with its binding partner (the BAI1 TSR3 domain), which may have stabilized the protein conformation and facilitated crystal packing .

  • High-resolution data collection: The complex structure was determined at 1.65 Å resolution, providing detailed information about the binding interface, including the positioning of water molecules and post-translational modifications .

  • Attention to post-translational modifications: The successful crystallization captured the importance of glycosylation in the binding interface, revealing "a well-defined electron density for an O-linked glucose-β−1,3-fucose modification on Thr424" .

  • Structure-guided mutagenesis: Following structural determination, key interface residues were mutated to validate their importance in complex formation. This iterative approach between structural studies and functional validation strengthened the biological relevance of the structural findings .

These techniques collectively enabled the determination of a high-resolution structure that provided significant insights into the molecular basis of RTN4R-ligand interactions, which can be applied to understanding Rtn4rl1 binding mechanisms.

How can surface plasmon resonance be optimized for measuring Rtn4rl1 binding interactions?

Surface plasmon resonance (SPR) has been successfully employed to measure nanomolar-affinity interactions between reticulon-4 receptors and their binding partners. To optimize SPR for Rtn4rl1 binding studies, consider the following approaches:

  • Protein quality and purity: Use highly purified recombinant proteins (>90% purity as determined by SDS-PAGE) to minimize non-specific binding and ensure reliable measurements .

  • Domain selection: Rather than immobilizing full-length proteins, focus on specific functional domains. For example, studies measuring RTN4R-BAI interactions used "recombinant proteins encompassing the ECDs of BAIs and RTN4Rs" .

  • Experimental design for nanomolar affinities: Configure the SPR experiment to accurately measure the expected nanomolar-range affinities. RTN4R family interactions with BAI proteins showed affinities ranging from 1.9 nM to 30.0 nM, requiring appropriate sensor chip selection and analyte concentration ranges .

  • Validation through mutagenesis: Include mutant proteins as controls to validate binding specificity. Mutations in key interface residues (e.g., Arg430Ala in BAI1 or His210Ala in RTN4R) that abolish binding in functional assays should show corresponding loss of SPR signal .

  • Post-translational modification awareness: Ensure that recombinant proteins used for SPR have relevant post-translational modifications, particularly when studying interactions involving the BAI TSR domains where O-fucosylation has been shown to be critical for binding .

By implementing these strategies, researchers can obtain reliable quantitative measurements of Rtn4rl1 binding interactions that correlate with functional outcomes in biological systems.

What approaches are most effective for studying Rtn4rl1 function in primary neuronal cultures?

Investigating Rtn4rl1 function in primary neuronal cultures requires specialized techniques that preserve the protein's native interactions and functions. Based on research approaches in the field, the following methodologies are recommended:

  • Expression pattern analysis: Utilize immunocytochemistry with validated antibodies to characterize the endogenous expression and subcellular localization of Rtn4rl1 in different neuronal types and at various developmental stages .

  • Axon growth and guidance assays: Given that RTN4-receptors were initially described as neuronal NoGo receptors that suppress axonal growth, quantitative assays measuring neurite outgrowth, growth cone collapse, or axon turning in response to Rtn4rl1 ligands provide functional readouts .

  • Protein-protein interaction studies: Employ co-immunoprecipitation, proximity ligation assays, or FRET to investigate the interaction between Rtn4rl1 and potential binding partners like BAI adhesion-GPCRs in a neuronal context .

  • Loss-of-function and gain-of-function approaches: Use RNAi-mediated knockdown, CRISPR/Cas9 genome editing, or overexpression of wild-type or mutant Rtn4rl1 to manipulate protein levels and assess the functional consequences on neuronal morphology and connectivity .

  • Calcium imaging and electrophysiology: Measure neuronal activity changes in response to Rtn4rl1 pathway manipulation to assess functional consequences on neuronal signaling and network activity.

These complementary approaches provide a comprehensive assessment of Rtn4rl1's functional roles in neuronal development, axon guidance, and potentially synaptic plasticity.

How can site-directed mutagenesis be effectively utilized to investigate structure-function relationships in Rtn4rl1?

Site-directed mutagenesis has proven instrumental in elucidating the structural determinants of Rtn4rl1 function, particularly regarding protein-protein interactions. A systematic approach includes:

  • Structure-guided mutation selection: Crystal structure analysis of the BAI1/RTN4R complex identified specific interface residues that are prime targets for mutagenesis, including key amino acids in the LRR domain that contact binding partners .

  • Functional categorization of mutations:

Mutation TypeExamplesFunctional Impact
Interface residuesHis210Ala, Tyr254Ala, Arg256Ala in RTN4RAbolished complex formation
Non-interface controlSer281Ala in RTN4RMinimal effect on binding
Glycosylation sitesThr424Val in BAI1 (blocks O-fucosylation)Abolished binding
Aromatic residuesTrp418Phe in BAI1Partial decrease in binding
  • Quantitative binding assays: Surface plasmon resonance (SPR) provides quantitative measurements of how mutations affect binding affinity, allowing for precise determination of each residue's contribution to interaction strength .

  • Domain-specific analysis: Comparing binding properties of different domains can reveal why certain domains interact while others don't. For example, the presence of Arg430 in BAI1 TSR3 but not in other TSR domains explains their differential binding to RTN4R .

  • Correlation with biological function: Extend mutagenesis studies beyond biochemical binding assays to cellular and neuronal contexts, testing how specific mutations affect axon growth, neuronal morphology, or signaling pathways.

This comprehensive mutagenesis approach not only maps the structural determinants of Rtn4rl1 interactions but also connects structural features to biological functions, providing mechanistic insights into how these proteins regulate neuronal development and function.

What methodologies are available for investigating Rtn4rl1 involvement in axonal regeneration and neurite outgrowth?

Investigating Rtn4rl1's role in axonal regeneration and neurite outgrowth requires specialized methodologies that capture the complex cellular processes involved:

  • In vitro axonal injury models: Microfluidic chambers or laser axotomy can be used to create controlled axonal injuries in cultured neurons expressing normal or modified levels of Rtn4rl1, allowing quantification of regeneration rates under various conditions .

  • Growth cone collapse assays: Application of recombinant Rtn4rl1 ligands to growing neurites can induce growth cone collapse in sensitive neurons. This can be quantified through time-lapse imaging and morphometric analysis .

  • 3D culture systems: Culturing neurons in three-dimensional matrices better recapitulates the in vivo environment for axonal growth and provides more physiologically relevant data on how Rtn4rl1 influences axon pathfinding and extension.

  • Molecular pathway analysis: Phosphorylation of downstream signaling molecules (e.g., RhoA, ROCK) can be monitored by western blotting or immunocytochemistry to understand how Rtn4rl1 activation affects intracellular signaling cascades that regulate cytoskeletal dynamics .

  • In vivo injury models: For advanced studies, spinal cord injury or optic nerve crush models in rodents, combined with viral-mediated manipulation of Rtn4rl1 expression, can assess the protein's role in regeneration under physiological conditions.

  • High-content imaging: Automated microscopy with image analysis algorithms enables quantitative assessment of multiple parameters (neurite length, branching, growth cone area) across large numbers of neurons, increasing statistical power and reproducibility.

These methodologies collectively provide a comprehensive toolkit for dissecting Rtn4rl1's functions in axonal growth regulation and its potential as a therapeutic target for promoting neural regeneration.

What protein interaction networks are associated with Rtn4rl1, and how can they be mapped experimentally?

Rtn4rl1 functions within a complex protein interaction network that regulates neuronal development and signaling. Experimentally mapping these networks requires multiple complementary approaches:

  • Unbiased interaction discovery: Proteomics-based approaches have led to unexpected discoveries, such as the high-affinity interaction between RTN4-receptors and BAI adhesion-GPCRs. These unbiased methods continue to be valuable for expanding our understanding of Rtn4rl1's interaction network .

  • Quantitative assessment of binding affinities: Surface plasmon resonance experiments with purified recombinant proteins have revealed nanomolar affinities between RTN4 receptors and binding partners. The BAI3-RTN4R interaction exhibited particularly high affinity (Kd = 1.9 nM), while the BAI1-RTN4RL2 interaction displayed lower but still significant affinity (Kd = 30.0 nM) .

  • Domain-specific interaction mapping: Truncation experiments have identified specific domains mediating interactions. For Rtn4rl1, the leucine-rich repeat (LRR) domain is the primary mediator of protein-protein interactions, while in binding partners like BAI1, specific thrombospondin type 1-repeat (TSR) domains (particularly TSR3) are critical .

  • Structural validation: X-ray crystallography at high resolution (1.65 Å) has provided detailed structural information about binding interfaces, including the role of post-translational modifications in creating high-affinity interaction surfaces .

  • Cellular validation: Cell adhesion assays and co-immunoprecipitation experiments confirm that interactions observed with purified proteins also occur in cellular contexts, validating their biological relevance .

By integrating these approaches, researchers can construct comprehensive maps of Rtn4rl1's interaction networks and understand how these networks contribute to its biological functions in neuronal development, axonal guidance, and potentially synaptic plasticity and regeneration.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.