Recombinant Rat Rhomboid domain-containing protein 3 (Rhbdd3)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Regulation

Studies using Rhbdd3-deficient mice reveal its role as a negative regulator of Toll-like receptor 3 (TLR3)-mediated natural killer (NK) cell activation :

Key Mechanisms:

  • TLR3 Feedback Inhibition: Rhbdd3 expression is upregulated in NK cells upon TLR3 stimulation (e.g., by poly(I:C)), forming a feedback loop to suppress excessive immune activation .

  • DAP12 Degradation: Rhbdd3 interacts with DAP12, promoting its proteasomal degradation and inhibiting MAPK (ERK, JNK, p38) signaling pathways in NK cells .

  • Cellular Interaction: Requires cell–cell contact with accessory cells (e.g., dendritic cells, Kupffer cells) to suppress IFN-γ and granzyme B production in NK cells .

Experimental Findings:

ParameterRhbdd3+/+ MiceRhbdd3−/− Mice
IFN-γ production (poly(I:C))LowElevated (2–3x increase)
MAPK activationReduced p-ERK/p-JNKEnhanced phosphorylation
Hepatic inflammationMildSevere (ALT/AST surge)

These findings highlight Rhbdd3’s role in mitigating TLR3-driven acute inflammation .

Research Applications

  • Immune Modulation Studies: Used to investigate NK cell tolerance and TLR3-related pathologies (e.g., hepatitis) .

  • Protein Interaction Mapping: Employed in yeast two-hybrid and co-IP assays to identify binding partners .

  • Therapeutic Target Exploration: Potential relevance in autoimmune diseases due to its inflammation-dampening effects .

Limitations and Future Directions

Current gaps include unresolved enzymatic activity and tissue-specific roles beyond the immune system. Future studies could leverage recombinant Rhbdd3 to explore its involvement in cancer apoptosis or mitochondrial dynamics .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We advise adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Rhbdd3; Rhomboid domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Rhbdd3
Target Protein Sequence
MHAWDPPASLSRALPLASSVLMLLLSCLWLLGAGPSLRLAPELLTEPWQVHRLLTHALGH TALPGLLLSLLLLPTLGWWQECHLGTLRFLHNSAVLALATGLLAVLLAGLGLSSAAGGCG YMPVHLAMLAGQSYYPGWPQRTLPPWLLPWLLLALTLLLSSEPPFLQLLCGLLAGLAYAA GAFRWLELSERRLQVLQEGVLCRTLAGCWPLKLLPTPGSLGELPVTYPAGVRPATPRPPY LASSSSWPHTDGFAQLPPGLGPGQLTWKNSERDLDWAGPSFASATPMWAALDEQMLQEGI QASLLDVSVQGSQNTLWSPKPSVSSLRLQQLQHMGFPTEQAAVALAATGRVEGAVSLLVE GLVDTEALVTEERSGPAHCKDTGVS
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid domain-containing protein 3 (Rhbdd3) and where is it expressed?

Rhbdd3 belongs to a family of proteins containing the rhomboid domain and is widely expressed throughout immune cells. It functions primarily as a negative regulator of immune responses, particularly in natural killer (NK) cells. The protein is selectively upregulated in NK cells upon Toll-like receptor 3 (TLR3) stimulation, suggesting it plays a feedback inhibitory role in TLR3-mediated immune responses . Expression analysis reveals that Rhbdd3 is rapidly and significantly increased in NK cells after in vivo injection of poly(I:C), a TLR3 agonist, but remains unchanged following IL-12/15 stimulation, indicating specificity in its regulation pathway .

How does Rhbdd3 contribute to immune regulation?

Rhbdd3 functions as a critical negative regulator of TLR3-triggered NK cell activation through several mechanisms. It inhibits the production of IFN-γ and expression of cytolytic molecules like granzyme B and perforin in NK cells following TLR3 stimulation. This regulation occurs in a cell-cell contact-dependent manner, requiring accessory cells such as dendritic cells (DCs) and Kupffer cells . At the molecular level, Rhbdd3 interacts with DNAX activation protein of 12 kDa (DAP12), promoting its degradation through the proteasome pathway, which consequently inhibits MAPK signaling activation in TLR3-triggered NK cells . These mechanisms collectively contribute to attenuating TLR3-triggered acute inflammation by controlling NK cell activation and accumulation in tissues, particularly the liver .

What molecular mechanisms underlie Rhbdd3's regulation of NK cell activation?

Rhbdd3 employs a sophisticated mechanism to regulate NK cell activation through its interaction with the adaptor protein DAP12. Following TLR3 stimulation with poly(I:C), both Rhbdd3 and DAP12 increase and aggregate significantly within NK cells, with coimmunoprecipitation analysis confirming their direct interaction . Mechanistically, Rhbdd3 promotes the proteasomal degradation of DAP12, as evidenced by increased DAP12 protein (but not mRNA) levels in Rhbdd3-knockdown or Rhbdd3-deficient cells. This relationship is further confirmed by the observation that proteasome inhibitor MG132 treatment increases DAP12 expression in Rhbdd3+/+ NK cells to levels comparable with Rhbdd3-/- NK cells .

The downstream consequence of this regulatory mechanism is the modulation of MAPK signaling pathways. In the presence of dendritic cells, Rhbdd3-/- NK cells exhibit significantly higher levels of phosphorylated ERK, JNK, and p38 following TLR3 stimulation compared to Rhbdd3+/+ NK cells. This enhanced MAPK activation is consistently observed in Rhbdd3-/- splenic NK cells after in vivo poly(I:C) stimulation, while NF-κB activation remains unaffected . This selective inhibition of MAPK pathways represents a critical mechanism by which Rhbdd3 negatively regulates TLR3-triggered NK cell activation.

How does the cell-cell contact dependency affect Rhbdd3 function in immunoregulation?

The regulatory function of Rhbdd3 in NK cell activation demonstrates a striking dependency on cell-cell contact with accessory cells such as dendritic cells and Kupffer cells. This dependency creates a complex microenvironmental regulation system that influences immune responses in tissues. Research has shown that Rhbdd3's inhibitory effect on TLR3-triggered IFN-γ and granzyme B expression in NK cells requires the presence and direct contact with these accessory cells .

This cell-cell contact dependency has profound implications for tissue-specific immune regulation, particularly in the liver. In TLR3-triggered hepatic inflammation models, the interaction between NK cells and Kupffer cells becomes critically important, with Rhbdd3 disrupting this interaction to prevent excessive inflammation. This is evidenced by experiments showing that depletion of Kupffer cells with clodronate liposomes reduces poly(I:C)-induced ALT levels in both Rhbdd3+/+ and Rhbdd3-/- mice to similar levels, confirming that Rhbdd3 negatively controls the interaction between NK cells and Kupffer cells in vivo . Understanding this cell-cell contact dependency is essential for developing targeted immunomodulatory approaches that might exploit the Rhbdd3 pathway.

What are the implications of Rhbdd3 in inflammatory disease models?

Rhbdd3 plays a protective role in acute inflammatory conditions, particularly TLR3-triggered hepatitis. In experimental models, Rhbdd3-/- mice exhibit significantly more severe liver inflammation after poly(I:C) injection, characterized by elevated serum ALT, AST, IFN-γ, and IL-6 levels, as well as increased inflammatory infiltrates and hepatic necrosis . The liver tissue of Rhbdd3-/- mice contains higher levels of pro-inflammatory cytokines, and these mice experience accelerated mortality following poly(I:C) challenge.

The central role of NK cells in this Rhbdd3-mediated protection is confirmed through several experimental approaches. NK cell depletion with anti-NK1.1 antibody significantly reduces the severity of liver inflammation and prevents mortality in both Rhbdd3+/+ and Rhbdd3-/- mice after poly(I:C) injection . Furthermore, adoptive transfer experiments demonstrate that NK cell-depleted mice receiving Rhbdd3-/- NK cells develop more severe inflammation (higher ALT, AST, IFN-γ, and IL-6 levels) than those receiving Rhbdd3+/+ NK cells following poly(I:C) challenge . These findings establish Rhbdd3 as a critical regulator of inflammatory conditions mediated by TLR3 activation, with particular relevance to acute hepatitis and potentially other inflammatory diseases where NK cells play significant roles.

What are the optimal approaches for generating recombinant Rhbdd3 protein?

The production of high-quality recombinant Rhbdd3 protein requires careful consideration of expression systems and purification strategies. Based on established methodologies for similar rhomboid domain-containing proteins, the optimal approach involves expression in Escherichia coli BL21 strain using a pET vector system with a fusion tag to facilitate purification . The inclusion of a 6×His tag allows for efficient purification using Ni2+-nitrilotriacetic acid (Ni-NTA) column chromatography.

A critical consideration in recombinant protein production for immunological studies is endotoxin removal. This can be effectively accomplished using specialized endotoxin removal kits, such as the ToxinEraser™ Endotoxin Removal Kit . For functional studies, it's essential to verify proper folding and activity of the recombinant protein, which may require additional biochemical assays specific to rhomboid domain proteins. Researchers should be aware that the hydrophobic nature of some regions in Rhbdd3 may affect solubility, potentially necessitating optimization of buffer conditions or consideration of alternative expression systems for certain applications.

What are the recommended methods for studying Rhbdd3 expression and regulation in different cell types?

Studying Rhbdd3 expression and regulation requires a multi-faceted approach combining molecular and cellular techniques. For temporal expression analysis following stimulation (e.g., with poly(I:C)), quantitative RT-PCR provides reliable data on transcriptional changes. This approach has successfully demonstrated that TLR3 agonists significantly increase Rhbdd3 expression in NK cells, while other stimuli like IL-12/15 do not affect its expression .

For protein-level analysis, Western blotting using specific antibodies against Rhbdd3 can track changes in protein expression. Confocal microscopy is valuable for visualizing subcellular localization and potential aggregation of Rhbdd3, particularly in response to stimuli. This technique has revealed that both Rhbdd3 and DAP12 increase and aggregate significantly after poly(I:C) stimulation . Flow cytometry can be employed to analyze Rhbdd3 expression in specific immune cell populations within heterogeneous samples. For in vivo regulation studies, a combination of tissue-specific RNA extraction and protein isolation from mice subjected to various immunological challenges (e.g., poly(I:C) injection) provides comprehensive data on the physiological regulation of Rhbdd3 expression.

What experimental systems are most appropriate for investigating Rhbdd3-protein interactions?

Investigating Rhbdd3-protein interactions requires sophisticated experimental systems that can capture both direct physical interactions and functional consequences. Coimmunoprecipitation (co-IP) has proven effective for identifying Rhbdd3's interaction with DAP12 in poly(I:C)-activated NK cells . For more sensitive detection of transient or weak interactions, proximity ligation assays might offer advantages over traditional co-IP.

Confocal microscopy with fluorescently tagged proteins provides valuable insights into the colocalization of Rhbdd3 with its interaction partners in living cells. This approach has successfully demonstrated the aggregation of both Rhbdd3 and DAP12 after poly(I:C) stimulation . For detailed characterization of interaction surfaces, yeast two-hybrid screening or mammalian two-hybrid systems could identify specific domains involved in protein-protein interactions. To investigate the functional consequences of these interactions, such as the Rhbdd3-mediated degradation of DAP12, proteasome inhibition experiments with MG132 combined with pulse-chase analysis can provide insights into protein stability and turnover rates .

For systems-level analysis, mass spectrometry-based interactome studies may uncover additional Rhbdd3 interaction partners beyond those already identified, potentially revealing new regulatory mechanisms in different cellular contexts or following various stimuli.

How can researchers interpret contradictory findings in Rhbdd3 functional studies?

Interpreting contradictory findings in Rhbdd3 functional studies requires careful consideration of experimental contexts and methodological differences. A systematic approach to resolving such contradictions includes:

  • Examination of cell type specificity: Rhbdd3 function may differ between cell types. While its role is well-established in NK cells, contradictory findings might emerge when studying different immune cell populations. For example, Rhbdd3's inhibitory effect on TLR3-triggered IFN-γ and granzyme B expression in NK cells depends on accessory cells such as dendritic cells and Kupffer cells .

  • Stimulus-specific effects: Rhbdd3 is selectively upregulated upon TLR3 stimulation but not IL-12/15 stimulation in NK cells . Contradictory findings might arise from studies using different stimulation conditions.

  • In vitro versus in vivo differences: Researchers should distinguish between findings from isolated cell systems and whole animal models. For example, the protective effect of Rhbdd3 against TLR3-triggered acute inflammation is most evident in in vivo systems where complex cell-cell interactions occur .

  • Consideration of compensatory mechanisms: In Rhbdd3-deficient models, other regulatory proteins might partially compensate for its absence, potentially masking or altering phenotypes in different experimental settings.

  • Technical variations: Differences in protein tags, expression levels in recombinant systems, or antibody specificities can contribute to apparently contradictory results across studies.

What statistical approaches are most appropriate for analyzing Rhbdd3 expression data across different experimental conditions?

The analysis of Rhbdd3 expression data across experimental conditions requires appropriate statistical approaches to ensure valid interpretation. For comparing Rhbdd3 expression levels between different treatment groups (e.g., poly(I:C) stimulated versus unstimulated), parametric tests such as Student's t-test or ANOVA are generally appropriate if data meet assumptions of normality and homogeneity of variance. For non-normally distributed data, non-parametric alternatives like Mann-Whitney U test or Kruskal-Wallis test should be considered.

For time-course experiments examining Rhbdd3 expression dynamics following stimulation, repeated measures ANOVA or mixed-effects models are more appropriate as they account for within-subject correlations. When analyzing the relationship between Rhbdd3 expression and other variables (e.g., inflammatory markers), correlation analyses (Pearson's or Spearman's) and regression models can provide insights into potential associations.

Sample size determination should consider the expected effect size based on preliminary data or literature values. Power analyses ensure that experiments are adequately powered to detect biologically meaningful differences in Rhbdd3 expression. For complex experimental designs with multiple factors, factorial ANOVA or linear mixed models allow for assessment of main effects and interactions.

In all cases, appropriate correction for multiple comparisons (e.g., Bonferroni, Tukey, or false discovery rate methods) should be applied when testing multiple hypotheses to control the type I error rate.

How can researchers distinguish between direct and indirect effects of Rhbdd3 in immune regulation?

Distinguishing between direct and indirect effects of Rhbdd3 in immune regulation represents a significant challenge that requires comprehensive experimental approaches. Based on current understanding, several strategies can help researchers make this distinction:

  • Cell-specific knockout models: Conditional Rhbdd3 knockout in specific cell types (e.g., NK cells versus dendritic cells) can help determine whether observed phenotypes result from direct effects in the cell of interest or indirectly through other cell types. This approach is particularly valuable given the established cell-cell contact dependency of Rhbdd3 function .

  • Mechanistic dissection: Detailed analysis of molecular pathways, as demonstrated with the Rhbdd3-DAP12-MAPK axis, can reveal direct molecular targets. The finding that Rhbdd3 directly interacts with DAP12 and promotes its degradation, consequently inhibiting MAPK activation, provides strong evidence for a direct mechanistic pathway .

  • Temporal analysis: High-resolution time-course experiments can help establish cause-and-effect relationships. Early events are more likely to represent direct effects of Rhbdd3, while later events may involve multiple intermediate steps.

  • Reconstitution experiments: In Rhbdd3-deficient systems, selective reconstitution with wild-type or mutant Rhbdd3 (lacking specific protein interaction domains) can help identify which functions require direct Rhbdd3 interaction versus those that occur through downstream effects.

  • Ex vivo and in vitro validation: Observations from in vivo models should be validated in controlled ex vivo or in vitro systems where cell composition and stimulation conditions can be precisely manipulated to isolate direct Rhbdd3 effects.

By combining these approaches, researchers can build a comprehensive understanding of how Rhbdd3 directly and indirectly influences immune regulation in different contexts.

What are the unresolved questions regarding Rhbdd3's molecular mechanism of action?

Despite significant progress in understanding Rhbdd3 function, several critical questions remain unresolved regarding its molecular mechanism of action. First, the complete spectrum of Rhbdd3 protein interactions beyond DAP12 requires comprehensive characterization. While the Rhbdd3-DAP12 interaction has been established , it remains unclear whether Rhbdd3 interacts with other adaptor proteins or signaling molecules in different contexts or cell types.

Second, the precise biochemical function of Rhbdd3's rhomboid domain needs further investigation. While classical rhomboid proteins function as intramembrane proteases, it remains to be determined whether Rhbdd3 possesses proteolytic activity beyond promoting DAP12 degradation, and if so, what its specific substrates might be in different cellular contexts. The structural basis for Rhbdd3's interaction with DAP12 and potential regulation by post-translational modifications also remains to be fully characterized.

Third, the upstream regulators of Rhbdd3 expression and activity are incompletely understood. While TLR3 stimulation has been shown to upregulate Rhbdd3 in NK cells , the transcription factors and signaling pathways mediating this upregulation have not been fully elucidated. Additionally, potential post-translational modifications that might regulate Rhbdd3 activity remain unexplored.

Finally, the potential role of Rhbdd3 in non-immune cells and in response to stimuli beyond TLR3 agonists represents an important area for future investigation, as this could reveal broader physiological functions for this regulatory protein.

How might therapeutic targeting of Rhbdd3 be developed for inflammatory conditions?

The established role of Rhbdd3 as a negative regulator of TLR3-triggered inflammation suggests potential therapeutic applications for inflammatory conditions. Several approaches for therapeutic targeting of Rhbdd3 warrant exploration:

  • Rhbdd3 agonists or mimetics: Compounds that enhance Rhbdd3 activity or mimic its inhibitory effects on DAP12-MAPK signaling could potentially dampen excessive NK cell activation in inflammatory conditions such as viral hepatitis or autoimmune disorders where TLR3 signaling plays a pathogenic role.

  • Cell type-specific delivery strategies: Given the cell-cell contact dependency of Rhbdd3 function , therapeutic approaches might target the interaction between NK cells and accessory cells like Kupffer cells. Nanoparticle-based delivery systems could potentially deliver Rhbdd3-modulating compounds specifically to these cellular interfaces.

  • Structure-based drug design: As more detailed structural information about Rhbdd3 and its interactions becomes available, structure-based approaches might yield small molecules that specifically enhance Rhbdd3-DAP12 interaction or promote DAP12 degradation.

  • Gene therapy approaches: For genetic diseases associated with Rhbdd3 dysfunction, gene therapy delivering functional Rhbdd3 to relevant immune cell populations could potentially restore normal immunoregulation.

  • Biomarker development: Rhbdd3 expression or activity levels might serve as biomarkers for inflammation severity or treatment response in conditions where TLR3-mediated inflammation plays a role.

The development of such therapeutic approaches requires further characterization of Rhbdd3's role across different inflammatory conditions and careful consideration of potential effects on anti-microbial and anti-tumor immunity, given NK cells' important functions in these processes.

What novel experimental techniques might advance our understanding of Rhbdd3 biology?

Advancing our understanding of Rhbdd3 biology will likely require implementation of cutting-edge experimental techniques across multiple disciplines. Several promising approaches include:

  • CRISPR-Cas9 genome editing: Generation of precise modifications in the Rhbdd3 gene, including domain-specific mutations, could provide insights into structure-function relationships. CRISPR-based screening approaches could also identify novel regulators or effectors of Rhbdd3 function.

  • Single-cell technologies: Single-cell RNA sequencing and mass cytometry could reveal cell-specific expression patterns and functional heterogeneity in Rhbdd3 regulation across immune cell populations, providing a more nuanced understanding of its role in complex immune responses.

  • Advanced imaging techniques: Super-resolution microscopy and live-cell imaging could provide detailed insights into the dynamics of Rhbdd3 localization, trafficking, and interaction with partners like DAP12 in real-time during NK cell activation.

  • Structural biology approaches: Cryo-electron microscopy or X-ray crystallography of Rhbdd3 alone and in complex with interaction partners could provide crucial insights into its molecular mechanism of action and facilitate structure-based drug design efforts.

  • Systems biology approaches: Integration of proteomics, transcriptomics, and metabolomics data using computational modeling could help place Rhbdd3 within broader immunoregulatory networks and predict its role in different physiological and pathological contexts.

  • Organoid and tissue-on-chip technologies: These approaches could allow study of Rhbdd3 function in more physiologically relevant three-dimensional environments that recapitulate the complex cell-cell interactions known to be important for its function .

Implementation of these advanced techniques, particularly in combination, promises to substantially advance our understanding of Rhbdd3 biology and potentially reveal new applications in diagnostic and therapeutic contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.