Recombinant Rat RING finger protein 112 (Rnf112)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Rnf112; Bfp; Zfp179; Znf179; RING finger protein 112; Brain finger protein; Zinc finger protein 179
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-631
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Rnf112
Target Protein Sequence
MPRPVLSVTAFCHRLGKRESKRSFMGNSSNSWSHASFPKLELGLGQRPSPPRESPTCSIC LERLREPISLDCGHDFCIRCFSTHRIPGCELPCCPECRKICKQKKGLRSLGERMKLLPQR PLPPALQETCAVRAERLLLVRINASGGLILRMGAINRCLKHPLARDTPVCLLAVLGEQHS GKSFLLDHLLRGLPGLESGDSTRPRAEGSLPGIRWGANGLTRGIWMWSHPFLLGKEGKKV AVFLVDTGDVMSPELSRETRVKLCALTMMLSSYQILNTSQELKDTDLGYLEMFVHVAEVM GKHYGMVPIQHLDLLVRDSSHHNKSGQGHVGDILQKLSGKYPKVQELLLGKRARCYLLPA PERQWVNKGQASPGGNTEDDFSHHFRAYISDVLSTAPQHAKSRCQGYWSEGRAMARGDRR LLTGQQLAQEIKNLSGWMGKSGPSFSSPDEMAAQLHDLRKVEAAKKEFEEYVRQQDIATK RIFSALRVLPDTMRNLLSTQKDAILARHGVALLCKEREQTLEALEAELQAEAKAFMDSYT MRFCGHLAAVGGAVGAGLMGLAGGVVGAGMAAAALAAEAGMVAAGAAVGATGAAVVGGGV GAGLAATVGCMEKEEDERVQGGDREPLLQEE
Uniprot No.

Target Background

Function

Recombinant Rat RING finger protein 112 (Rnf112) is an E3 ubiquitin-protein ligase crucial for neuronal differentiation, encompassing neurogenesis and gliogenesis during brain development. During embryogenesis, it initiates neuronal differentiation by inducing G0/G1 cell cycle arrest via upregulation of cell-cycle regulatory proteins. Its role extends beyond fetal development, influencing adult neural function and protecting nervous tissue cells from oxidative stress damage. Rnf112 exhibits both GTPase and E3 ubiquitin-protein ligase activities. It regulates dendritic spine density and synaptic neurotransmission, with GTP hydrolysis contributing to the maintenance of dendritic spine density.

Gene References Into Functions
  1. Neurolastin, identified as a dynamin family GTPase affecting endosome size and spine density. PMID: 26212327
Database Links

KEGG: rno:24916

STRING: 10116.ENSRNOP00000003228

UniGene: Rn.7544

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, GB1 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein. Membrane; Peripheral membrane protein. Cytoplasm. Nucleus. Nucleus, nuclear body. Nucleus, nucleoplasm. Endosome. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle. Cell junction, synapse, postsynaptic density. Perikaryon. Cell projection, neuron projection.
Tissue Specificity
Predominantly expressed in brain.

Q&A

What is Rnf112 and what are its alternative designations in scientific literature?

Rnf112 (Ring Finger Protein 112) is a member of the RING finger protein family of transcription factors. It contains a specialized zinc finger domain that binds two zinc ions and mediates protein-protein interactions . The protein is alternatively known as Brain Finger Protein (Bfp), Zinc finger protein 179 (Zfp179), and Znf179 . These alternative designations should be included in literature searches to ensure comprehensive coverage of relevant research. The rat Rnf112 gene is located on Chromosome 10 .

What is known about the expression pattern of Rnf112?

Rnf112 shows abundant expression in the brain, with expression patterns regulated during brain development . This temporal regulation suggests critical roles in proper brain formation and neuronal differentiation. While the brain shows the highest expression levels, Rnf112 also appears to be important in other developmental contexts, particularly in embryonic vascular development, as evidenced by the vascular phenotypes observed in knockout models .

What are the primary biological functions of Rnf112?

Rnf112 serves several important biological functions:

  • Promotion of neuronal differentiation through inhibition of cell cycle progression

  • Contribution to proper brain development and size maintenance

  • Essential role in embryonic vascular development, with knockout models showing vascular defects

  • Maintenance of motor coordination and spatial memory functions in the adult brain

  • Potential transcriptional regulation through its classification as a transcription factor

What detection methods are appropriate for studying Rnf112 expression?

Several complementary methods can be employed to detect and quantify Rnf112:

MethodApplicationTechnical Considerations
ELISAQuantitative protein detectionDetection range: 0.156-10 ng/ml; Optimal for tissue homogenates and biological fluids
ImmunohistochemistrySpatial expression mappingRequires validated antibodies specific to rat Rnf112
Western BlottingSemi-quantitative protein analysisUseful for determining relative abundance across samples
qRT-PCRmRNA expression analysisRequires careful primer design specific to Rnf112 transcripts

For most research applications, combining protein-level detection (ELISA/Western blot) with localization studies (immunohistochemistry) provides the most comprehensive characterization.

How should researchers approach Rnf112 knockout studies in rodent models?

When designing Rnf112 knockout studies, researchers should consider:

  • Genetic Background Selection: The survival rate of homozygous Rnf112 knockout mice significantly increases in a mixed genetic background (129/sv and C57BL/6) . This background effect is crucial when planning studies that extend beyond embryonic development.

  • Knockout Strategy Options:

    • Complete knockout: May result in embryonic lethality due to vascular defects in many cases

    • Conditional knockouts: Using tissue-specific promoters can overcome embryonic lethality

    • Inducible systems: Allow temporal control of gene deletion to distinguish developmental from adult functions

  • Comprehensive Phenotypic Analysis: Based on known Rnf112 functions, knockout studies should assess:

    • Embryonic vascular development

    • Growth trajectories and weight gain

    • Brain morphology and size using 3D MRI imaging

    • Behavioral testing focused on motor coordination and spatial learning/memory

What technical considerations are important when using recombinant Rnf112 in experimental studies?

When working with recombinant Rat RING finger protein 112, researchers should address these key considerations:

  • Storage and Stability:

    • Store according to manufacturer recommendations (typically -20°C with 50% glycerol)

    • Avoid repeated freeze-thaw cycles which reduce protein activity

    • The stability of commercial preparations is typically characterized by an activity loss rate of less than 5% within the expiration period (often 6 months)

  • Quality Assessment:

    • Verify protein sequence integrity compared to native Rnf112

    • Assess purity and proper folding, particularly of the critical RING domain

    • Validate activity in preliminary experiments before conducting full-scale studies

  • Experimental Applications:

    • Optimal dilutions and concentrations should be determined empirically for each application

    • Use appropriate sample types: tissue homogenates, cell lysates, and biological fluids

    • Note that recombinant proteins may lack post-translational modifications present in vivo

What is the role of Rnf112 in embryonic vascular development?

Research has revealed an unexpected but critical role for Rnf112 in vascular development:

  • Embryonic Lethality: Most Rnf112-/- embryos exhibit blood vascular defects and die in utero, indicating an essential role in vascular development .

  • Genetic Modifiers: The increase in survival rate of homozygous knockouts in mixed genetic backgrounds suggests the presence of modifying genetic factors that can partially compensate for Rnf112 deficiency .

  • Potential Mechanisms: While the exact pathways remain to be fully characterized, Rnf112 might influence vascular development through:

    • Regulation of endothelial cell proliferation via its cell cycle inhibition properties

    • Interactions with angiogenic signaling pathways

    • Involvement in neurovascular development coordination

This vascular phenotype expands our understanding of Rnf112 beyond neuronal functions and suggests important roles in the coordination of neural and vascular development.

What molecular mechanisms underlie Rnf112's role in neuronal differentiation?

At the molecular level, Rnf112 promotes neuronal differentiation through several mechanisms:

  • Cell Cycle Regulation: Rnf112 inhibits cell cycle progression, which is a critical step in the transition from proliferating neural progenitors to post-mitotic neurons .

  • Transcriptional Regulation: As a member of the RING finger protein family of transcription factors, Rnf112 likely regulates the expression of genes involved in neuronal specification and maturation .

  • Protein Interactions: The RING domain typically mediates protein-protein interactions and may possess E3 ubiquitin ligase activity, suggesting Rnf112 might regulate the stability of proteins involved in neural development.

  • Developmental Timing: The regulated expression of Rnf112 during brain development indicates precise temporal control of its activity is necessary for proper neuronal differentiation .

What cognitive and motor phenotypes are associated with Rnf112 deficiency?

Rnf112 deficiency leads to specific neurological phenotypes that provide insight into its functional roles:

These findings collectively suggest Rnf112 plays important roles in the development and function of neural circuits underlying both motor coordination and spatial cognition.

How should samples be prepared for optimal Rnf112 detection using ELISA?

For optimal detection of Rnf112 using ELISA, sample preparation requires careful attention to several factors:

  • Sample Processing:

    • Fresh or frozen tissue should be homogenized in appropriate lysis buffer containing protease inhibitors

    • Maintain cold temperature throughout processing (4°C) to prevent protein degradation

    • Filter samples to remove particulates that might interfere with the assay

  • Concentration Optimization:

    • Samples must be diluted to fall within the detection range (typically 0.156-10 ng/ml)

    • Perform preliminary dilution series to determine optimal concentrations

    • Ensure consistent protein concentrations across samples (determined by Bradford or BCA assay)

  • Assay Conditions:

    • The stability of commercial kits is optimized when procedures and lab conditions are strictly controlled

    • For reproducible results, the entire assay should ideally be performed by the same researcher

    • Follow kit-specific storage instructions and observe the validity period (typically 6 months)

What imaging techniques are most appropriate for studying Rnf112 in brain development?

Multiple imaging techniques offer complementary insights when studying Rnf112 in brain development:

  • In vivo 3D MRI Imaging:

    • Particularly valuable for assessing brain size differences, as demonstrated in Rnf112-/- mice

    • Allows longitudinal studies in the same animal to track developmental trajectories

    • Can detect structural abnormalities in specific brain regions

  • Immunofluorescence Microscopy:

    • Confocal microscopy for cellular localization of Rnf112

    • Co-localization studies with developmental markers

    • Examination of morphological changes in neurons following Rnf112 manipulation

  • Electron Microscopy:

    • Immunogold labeling for ultrastructural localization

    • Analysis of synapse formation and neuronal connectivity in Rnf112-deficient models

  • Functional Imaging:

    • Calcium imaging to assess activity patterns in neural networks

    • Correlation of neural activity with behavioral phenotypes observed in Rnf112-/- animals

The optimal approach typically involves combining these techniques to connect molecular-level protein function with cellular and system-level developmental outcomes.

What are the most promising directions for future Rnf112 research?

Several important research directions should be prioritized to advance our understanding of Rnf112:

  • Molecular Interactome Mapping: Comprehensive identification of Rnf112 binding partners in different developmental contexts would clarify its mechanisms of action.

  • Cell-Type Specific Functions: Determining whether Rnf112 functions differently across neural cell types (neurons, astrocytes, oligodendrocytes) could reveal specialized roles.

  • Developmental Stage-Specific Roles: Further investigation of the differential functions of Rnf112 during embryonic development versus adult brain maintenance.

  • Potential Disease Relevance: Given its roles in brain development and function, exploring Rnf112's potential involvement in neurodevelopmental disorders may yield valuable insights.

  • Therapeutic Applications: Investigation of whether modulating Rnf112 activity could have therapeutic potential for conditions involving aberrant neuronal differentiation or vascular development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.