Recombinant Rat Secretory carrier-associated membrane protein 4 (Scamp4)

Shipped with Ice Packs
In Stock

Description

Membrane Trafficking

SCAMP4 localizes to recycling endosomes and trans-Golgi networks, influencing vesicle-mediated secretion . Its conserved amphiphilic segments (e.g., residues 199–215) bind phospholipid membranes, facilitating carrier vesicle formation .

Senescence-Associated Secretory Phenotype (SASP)

SCAMP4 stabilizes in senescent cells (e.g., irradiated fibroblasts) and promotes SASP factor secretion:

  • Key SASP Factors Enhanced: IL-6, IL-8, GDF-15, CXCL1

  • Regulatory Mechanism: Ubiquitination at Lys4/Lys185 triggers proteasomal degradation in proliferating cells, while senescence blocks this process .

Overexpression experiments demonstrate SCAMP4's dual role:

  • Increases SASP factor secretion by 2–5 fold

  • Elevates senescence markers (p16, p53) and reduces cell proliferation

Experimental Tools

  • Cloning: Available as a Myc-DDK-tagged ORF clone (pLenti-C-Myc-DDK-P2A-Puro) for lentiviral expression

  • Antibodies: Polyclonal antibodies target the C-terminal epitope (residues 209–222) with 85%–87% cross-reactivity in rodents

Disease Associations

ConditionObserved SCAMP4 AlterationSource
Cellular SenescenceUpregulated SCAMP4 stabilizes SASP
Breast Cancer (BRCA)S209L mutation disrupts degron motifs
Hepatocellular Carcinoma (LIHC)E202Q mutation linked to COP1 binding

Gene-Chemical Interactions

SCAMP4 expression responds to multiple stimuli:

Chemical/AgentEffect on SCAMP4Experimental Model
17β-Estradiol + cAMP↑ mRNA expressionRat uterine tissue
Bisphenol A/F↑ Protein levelsHuman cell lines
Arsenic Trioxide↑ mRNA expressionLeukemia cells
Doxorubicin↑ Protein in senescent cellsFibroblasts

Future Directions

Current research gaps include:

  1. Structural resolution of SCAMP4's membrane core by cryo-EM

  2. In vivo validation of SCAMP4's role in age-related pathologies

  3. Therapeutic targeting of SCAMP4 ubiquitination sites

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Scamp4; Secretory carrier-associated membrane protein 4; SCAMP-4; Secretory carrier membrane protein 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Scamp4
Target Protein Sequence
MAGKENNFPPLPHFLPLKPCFYQDFSDEIPVEHQVLVKRIYRLWMFYCTTLGVNLVACLA WWIAGGAGANFGLAMLWLVLFTPCSYVCWFRPAYKAFRADSSFNFMAFFFIFGAQFVLTV IQAIGFSGWGACGWLATIGFFGTSVGAAVVMLIPAIMFSLSAVVMAITIVKVHRIYRGAG GSLQKAQTEWSAGTWRNPPSREAQFNSFSGNSLPEYPTVPSYSTSGSQWP
Uniprot No.

Target Background

Function
Secretory carrier-associated membrane protein 4 (Scamp4) is likely involved in membrane protein trafficking.
Database Links

KEGG: rno:65170

STRING: 10116.ENSRNOP00000024980

UniGene: Rn.7309

Protein Families
SCAMP family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Secretory Carrier-Associated Membrane Protein 4 (Scamp4)?

Scamp4 is an integral membrane protein belonging to the SCAMP family, which functions in membrane trafficking processes. Unlike other SCAMPs that are 32-38 kDa, Scamp4 is approximately 25 kDa and lacks most of the N-terminal hydrophilic domain present in other family members. It still contains the membrane core considered to be the functional domain of all SCAMPs. The protein is part of a broadly conserved family found across plant and animal kingdoms, though no obvious fungal homologues have been identified . Rat Scamp4 consists of 230 amino acids with a full sequence that includes multiple transmembrane domains and conserved amphiphilic segments .

What structural features characterize rat Scamp4 compared to other SCAMP family members?

Rat Scamp4 differs from other SCAMP family members in several key aspects:

  • Size: Scamp4 is approximately 25 kDa, while other SCAMPs are 32-38 kDa .

  • N-terminal domain: Scamp4 lacks most of the N-terminal hydrophilic domain that is present in other SCAMPs .

  • Membrane core: Despite these differences, Scamp4 retains the highly conserved membrane core that contains four putative transmembrane spans and three amphiphilic segments, which are the most conserved structural elements across the family .

The authenticity of this shorter form has been confirmed by Northern and Western blotting, suggesting that the membrane core portion of larger SCAMPs encodes the functional domain . This supports the hypothesis that Scamp4, despite its truncated nature, likely shares similar functions with other family members.

How does the membrane topology of Scamp4 compare to other SCAMP family members?

The membrane topology of Scamp4, while sharing core features with other SCAMP family members, has some distinct characteristics:

Studies using synthetic peptides corresponding to these amphiphilic segments have demonstrated their binding to phospholipid membranes, with circular dichroism spectroscopy showing that the central amphiphilic segment linking transmembrane spans 2 and 3 adopts an α-helical conformation . This structural arrangement likely contributes to the interfacial activity proposed for SCAMP proteins.

What role does Scamp4 play in membrane trafficking and how does it differ from other SCAMP proteins?

Scamp4's role in membrane trafficking appears to be fundamentally similar to other SCAMP family members, though with potential functional nuances due to its structural differences:

  • Core function: As part of the SCAMP family, Scamp4 is implicated in membrane trafficking processes within secretory and endocytic pathways . The retention of the membrane core domain in Scamp4 suggests it maintains the essential trafficking functions of the family.

  • Functional domain conservation: Studies have indicated that the membrane core alone, which is fully present in Scamp4, is likely the functional domain of all SCAMPs. The highly conserved amphiphilic segments within this core may carry out an interfacial activity essential for membrane dynamics .

  • Differential regulation: The absence of most of the N-terminal hydrophilic domain in Scamp4 suggests it may be subject to different regulatory mechanisms compared to larger SCAMPs. The N-terminal domains of other SCAMPs contain NPF repeats, leucine heptad repeats enriched in charged residues, and proline-rich SH3-like and/or WW domain-binding sites, which are likely involved in protein-protein interactions and regulation .

  • Evolutionary perspective: The conservation of Scamp4 alongside longer SCAMP proteins suggests a specialized or complementary role in membrane trafficking. The existence of both forms across species indicates distinct functional requirements that have been maintained through evolution .

Research using topology mapping and limited proteolysis approaches similar to those used for SCAMP1 would help clarify the specific functions of Scamp4 and how they might differ from those of the larger SCAMP proteins .

What chemical interactions and experimental conditions affect Scamp4 expression?

Scamp4 expression is modulated by various chemical compounds and experimental conditions, as evidenced by gene-chemical interaction annotations:

Chemical CompoundEffect on Scamp4Experimental EvidenceSpecies Relevance
1,2-dimethylhydrazineIncreases expressionISO (based on mouse data)Rat/Mouse
17beta-estradiolMultiple interactionsISO (based on human data)Rat/Human
2,3,7,8-tetrachlorodibenzodioxineIncreases expressionEXP (direct experimental)Rat
2,4-dinitrotolueneAffects expressionEXP (direct experimental)Rat
3,4-methylenedioxymethamphetamineIncreases expressionISO (based on mouse data)Rat/Mouse
3-isobutyl-1-methyl-7H-xanthineMultiple interactionsISO (based on human data)Rat/Human

These interactions suggest that Scamp4 expression is responsive to various environmental toxins, hormones, and pharmacological agents . This information is valuable for researchers designing experiments to study Scamp4 regulation or using it as a potential biomarker for exposure to these compounds.

What are the optimal conditions for reconstitution and storage of recombinant rat Scamp4 protein?

Based on manufacturer recommendations for recombinant rat Scamp4 protein, the following protocols should be followed for optimal reconstitution and storage:

  • Reconstitution procedure:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended default is 50%)

    • Aliquot for long-term storage

  • Storage conditions:

    • Store the received lyophilized powder at -20°C/-80°C

    • After reconstitution, store aliquots at -20°C/-80°C for long-term storage

    • Working aliquots can be stored at 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as they can degrade the protein

  • Buffer composition:

    • The provided protein is in a Tris/PBS-based buffer containing 6% Trehalose, pH 8.0

    • This buffer formulation helps maintain protein stability during storage

These conditions are designed to preserve the structural integrity and functional activity of the recombinant protein for research applications. Proper handling and storage are critical for maintaining consistent experimental results when working with recombinant Scamp4 protein.

What expression systems and purification strategies are most effective for producing functional recombinant rat Scamp4?

Based on available data and common practices in membrane protein production, the following expression and purification strategies are recommended for recombinant rat Scamp4:

  • Expression systems:

    • E. coli: The commercially available recombinant rat Scamp4 is successfully expressed in E. coli with an N-terminal His tag . This suggests that bacterial expression systems can effectively produce the protein despite its multiple transmembrane domains.

    • Alternative systems: For studies requiring post-translational modifications or membrane insertion mimicking mammalian systems, insect cells (baculovirus expression system) or mammalian cell lines may be preferable, though these are not documented in the provided search results.

  • Purification strategies:

    • Affinity chromatography: The use of His-tag enables efficient purification using nickel or cobalt affinity columns

    • Size exclusion chromatography: As a secondary purification step to achieve high purity and remove aggregates

    • Detergent selection: Critical for membrane protein solubilization; mild detergents like DDM (n-Dodecyl-β-D-maltoside) or LMNG (Lauryl maltose neopentyl glycol) are often effective for maintaining membrane protein structure

  • Quality control:

    • SDS-PAGE analysis: The commercially available preparation shows >90% purity as determined by SDS-PAGE

    • Mass spectrometry: For confirmation of protein identity and integrity

    • Functional assays: Depending on the intended application, membrane binding assays or interaction studies with known partners

For researchers pursuing structural or detailed functional studies, it may be beneficial to test multiple constructs with different tag positions (N- or C-terminal) and various fusion partners to optimize expression and solubility, given the challenges inherent in membrane protein production.

What analytical techniques are most informative for studying Scamp4 structure and membrane interactions?

Based on previous studies of SCAMP family proteins, several analytical techniques have proven valuable for elucidating the structure and membrane interactions of these proteins:

  • Membrane topology mapping techniques:

    • Alkaline phosphatase (PhoA) fusion approach: This method has been successfully applied to SCAMP1 and could be adapted for Scamp4 to determine membrane topology. The technique involves creating fusion proteins with truncations at different points in the sequence and analyzing the resulting alkaline phosphatase activity to identify regions that are cytoplasmic versus extracellular .

    • Protease accessibility assays: Limited proteolysis with proteases like trypsin can reveal accessible regions of the protein, helping to map topology when performed on membrane-embedded protein .

  • Structural analysis methods:

    • Circular dichroism (CD) spectroscopy: Previously used to demonstrate that the central amphiphilic segment of SCAMPs adopts an α-helical conformation upon membrane binding .

    • Spin labeling combined with site-directed spin labeling (SDSL) and electron paramagnetic resonance (EPR): Can provide information about specific amino acid positions relative to the membrane interface.

    • Fluorescence spectroscopy: Using environmentally sensitive probes to assess membrane insertion of specific domains.

  • Membrane interaction assays:

    • Synthetic peptide binding studies: As demonstrated in previous work, synthetic peptides corresponding to the amphiphilic segments can be used to study their binding to phospholipid membranes .

    • Liposome binding assays: To quantify the interaction of purified Scamp4 with various lipid compositions.

    • Monolayer insertion experiments: To measure the ability of Scamp4 or its domains to penetrate lipid monolayers of defined surface pressure.

  • Advanced structural techniques:

    • Cryo-electron microscopy (cryo-EM): For potential determination of full-length protein structure in membrane-like environments.

    • Nuclear magnetic resonance (NMR) spectroscopy: Particularly suited for studying dynamics of membrane proteins and their interactions with lipids.

These methodologies can provide complementary information about how Scamp4 interacts with membranes and potential differences in these interactions compared to other SCAMP family members.

How can researchers effectively design experiments to investigate the functional differences between Scamp4 and other SCAMP family members?

To investigate functional differences between Scamp4 and other SCAMP family members, researchers should consider the following experimental design strategies:

  • Comparative expression and localization studies:

    • Generate fluorescently tagged constructs of Scamp4 and other SCAMP proteins (particularly SCAMP1)

    • Perform co-localization studies in relevant cell types to identify potential differences in subcellular distribution

    • Use live-cell imaging to track dynamic trafficking behaviors in response to stimuli

  • Domain swapping and mutational analysis:

    • Create chimeric proteins exchanging domains between Scamp4 and other SCAMPs

    • Focus particularly on the N-terminal domain absent in Scamp4 but present in other SCAMPs

    • Generate targeted mutations in the conserved amphiphilic segments within the membrane core to assess their functional importance

  • Protein-protein interaction mapping:

    • Employ proximity labeling approaches (BioID, APEX) with Scamp4 and other SCAMPs as baits

    • Perform co-immunoprecipitation followed by mass spectrometry to identify differential interaction partners

    • Use yeast two-hybrid or mammalian two-hybrid systems to test specific interaction hypotheses

  • Functional assays in cellular models:

    • CRISPR-Cas9 knockout of Scamp4 versus other SCAMP family members

    • Rescue experiments with various SCAMP constructs to identify non-redundant functions

    • Quantitative assays of secretion, endocytosis, and membrane recycling in cells with manipulated SCAMP expression

  • In vitro reconstitution:

    • Reconstitute purified Scamp4 and other SCAMPs into liposomes

    • Measure effects on membrane properties (curvature, fusion, fission)

    • Assess interactions with other trafficking machinery components in reconstituted systems

A systematic approach combining these strategies would help delineate the unique functions of Scamp4 versus those shared with other family members, particularly focusing on how the absence of the N-terminal domain affects function while maintaining the conserved membrane core.

What cell models and experimental systems are most appropriate for studying the physiological role of rat Scamp4?

To effectively study the physiological role of rat Scamp4, researchers should consider the following cell models and experimental systems:

  • Primary cell cultures:

    • Rat neurons and glial cells: Given the expression of SCAMPs in synaptic vesicles and potential roles in neurotransmission

    • Rat exocrine cells (e.g., pancreatic acinar cells): Appropriate for studying regulated secretion

    • Rat endocrine cells: For investigating hormone secretion pathways in which membrane trafficking is crucial

  • Cell lines:

    • PC12 cells: Rat pheochromocytoma cell line with regulated secretory pathway

    • RBL-2H3 cells: Rat basophilic leukemia cells useful for studying regulated secretion and endocytosis

    • Primary rat hepatocytes or hepatoma cell lines: For studying polarized trafficking in epithelial cells

  • Organoid models:

    • Rat intestinal organoids: For studying Scamp4 in polarized epithelial trafficking

    • Rat brain organoids: To examine roles in neuronal development and function in a more physiological 3D context

  • In vivo models:

    • Transgenic rat models: Using CRISPR-Cas9 to generate Scamp4 knockout or knockin rats

    • Stereotactic injection of viral vectors: For region-specific manipulation of Scamp4 expression in rat brain

    • In utero electroporation: For developmental studies of Scamp4 function

  • Stimulus-response experimental systems:

    • Secretion assays: Measuring regulated release of cargo in response to physiological stimuli

    • Endocytosis tracking: Quantifying uptake of labeled ligands or plasma membrane components

    • Membrane recycling assays: Following the fate of internalized membrane proteins

  • Pathological models:

    • Chemical exposure models: Based on the gene-chemical interaction data showing modulation of Scamp4 by various compounds

    • Stress response models: To investigate potential roles in cellular adaptations to environmental challenges

When designing experiments with these systems, researchers should consider the expression levels of endogenous Scamp4 and potential compensatory mechanisms by other SCAMP family members. Combination approaches, such as acute depletion of Scamp4 in cells derived from transgenic models, may be particularly informative for distinguishing immediate versus adaptive effects of Scamp4 loss.

What are the critical control experiments needed when studying recombinant rat Scamp4 protein in membrane trafficking research?

When conducting membrane trafficking research with recombinant rat Scamp4 protein, the following critical control experiments should be incorporated:

  • Protein quality and functionality controls:

    • Verification of protein purity: SDS-PAGE and Western blotting to confirm the absence of degradation products or contaminating proteins

    • Assessment of proper folding: Circular dichroism spectroscopy to verify secondary structure elements

    • Validation of membrane association: Liposome binding assays comparing wild-type Scamp4 with known membrane binding defective mutants

  • Specificity controls:

    • Comparison with other SCAMP family members: Include recombinant SCAMP1 or other family proteins in parallel experiments

    • Non-SCAMP membrane protein controls: Include other membrane trafficking proteins of similar size/topology but different function

    • Mutant Scamp4 controls: Versions with disrupted amphiphilic segments or transmembrane domains

  • System validation controls:

    • Positive controls: Include well-characterized membrane trafficking events known to be sensitive to manipulation

    • Negative controls: Assess trafficking pathways not expected to involve Scamp4

    • Dose-response relationships: Demonstrate concentration-dependent effects of recombinant Scamp4

  • Technical controls for specific assays:

    • For reconstitution experiments: Empty liposomes and liposomes containing irrelevant proteins

    • For cellular uptake studies: Fluorescently labeled but non-functional Scamp4 variants

    • For binding assays: Competition with unlabeled protein to demonstrate specificity

  • Physiological relevance controls:

    • Comparison of recombinant protein effects with endogenous protein manipulation (knockdown/overexpression)

    • Rescue experiments: Testing whether recombinant Scamp4 can restore function in Scamp4-depleted cells

    • Context-dependence: Testing effects across multiple cell types or membrane compositions

  • Interaction controls:

    • Pull-down assays with known SCAMP-interacting proteins versus non-interacting proteins

    • Demonstration that interactions are specific to functional domains conserved in Scamp4

    • Competition experiments with synthetic peptides corresponding to interaction domains

How should researchers interpret differences in experimental results between rat Scamp4 and its human or mouse orthologs?

When interpreting differences in experimental results between rat Scamp4 and its human or mouse orthologs, researchers should consider several factors:

  • Sequence and structural conservation:

    • Perform detailed sequence alignments to identify conserved versus divergent regions

    • Calculate percent identity/similarity between orthologs, with particular attention to functional domains

    • Assess whether differences occur in the conserved membrane core or in more variable regions

  • Expression pattern differences:

    • Compare tissue-specific expression patterns across species

    • Determine whether ortholog expression is regulated by similar transcription factors and signaling pathways

    • Consider whether differences in expression levels might explain functional variations

  • Experimental system considerations:

    • Evaluate whether differences might be attributed to species-specific cellular machinery

    • Consider the compatibility of heterologous expression systems with proteins from different species

    • Assess whether differences in post-translational modifications might explain functional variation

  • Evolutionary context:

    • Analyze whether observed differences reflect adaptive evolution to species-specific requirements

    • Consider whether paralogous SCAMP proteins might compensate differently across species

    • Evaluate conservation of interaction partners across species

  • Statistical analysis approach:

    • Ensure appropriate statistical methods for cross-species comparisons

    • Consider greater biological replication when comparing across species

    • Use multivariate analysis to identify patterns of differences rather than focusing on individual parameters

  • Interpretation framework:

    • Distinguish between core conserved functions versus species-specific adaptations

    • Consider that rat models may show differences from human systems that impact translational relevance

    • Evaluate whether differences represent fundamental functional divergence or contextual variation

Several gene-chemical interaction studies have used data from mouse or human Scamp4 to make inferences about rat Scamp4 , suggesting substantial functional conservation despite potential sequence differences. When interpreting such cross-species data, researchers should explicitly acknowledge the limitations and provide evidence supporting the validity of cross-species extrapolation.

What statistical approaches are most appropriate for analyzing Scamp4 protein-membrane interaction data?

For analyzing Scamp4 protein-membrane interaction data, researchers should consider the following statistical approaches based on the experimental design and data types:

  • For binding affinity measurements:

    • Non-linear regression analysis: Fitting binding data to appropriate models (e.g., one-site binding, Hill equation)

    • Scatchard or Hill plots: For visualizing and analyzing binding characteristics

    • Comparison of binding parameters (Kd, Bmax) using t-tests or ANOVA with appropriate post-hoc tests

    • Bootstrap methods for robust confidence interval estimation when sample sizes are small

  • For membrane insertion/association experiments:

    • ANOVA or mixed-effects models: When comparing insertion across multiple conditions or lipid compositions

    • Repeated measures designs: For time-course studies of membrane association

    • Principal component analysis: To identify patterns in complex datasets with multiple membrane parameters

  • For microscopy and localization studies:

    • Pearson's or Mander's correlation coefficients: For co-localization analysis

    • Object-based co-localization analysis: For discrete punctate structures

    • Ripley's K-function or nearest neighbor analysis: For spatial distribution patterns

    • Image segmentation and classification approaches: For high-content analysis of membrane distribution

  • For biophysical measurements:

    • Time series analysis: For dynamic membrane interaction measurements

    • Curve fitting to theoretical models: For circular dichroism data or other spectroscopic measurements

    • Bayesian approaches: For integrating multiple measurement types with prior knowledge

  • For comparing Scamp4 with other SCAMP family members:

    • Multivariate ANOVA (MANOVA): When comparing multiple parameters simultaneously

    • Linear discriminant analysis: To identify parameters that best distinguish between family members

    • Hierarchical clustering: To visualize relationships between different SCAMP proteins based on membrane interactions

  • General statistical considerations:

    • Account for batch effects and experimental variability using mixed models

    • Apply appropriate multiple testing corrections when performing numerous comparisons

    • Consider Bayesian approaches for small sample sizes typical in biophysical studies

    • Use power analysis to determine appropriate sample sizes for detecting biologically relevant differences

When reporting results, researchers should clearly state the statistical methods used, including software packages, and provide measures of uncertainty (confidence intervals) along with p-values to facilitate interpretation of biological significance versus statistical significance.

How can researchers effectively integrate structural, functional, and interaction data to develop comprehensive models of Scamp4 activity in membrane trafficking?

Integrating diverse data types to develop comprehensive models of Scamp4 activity requires systematic approaches that connect structural insights with functional observations and interaction networks:

  • Multi-level data integration approach:

    • Structure-function mapping: Systematically correlate structural features (e.g., amphiphilic segments, transmembrane domains) with specific functional outcomes

    • Interaction-function network analysis: Connect Scamp4 protein interactions with functional effects using network analysis tools

    • Temporal sequence modeling: Develop models that capture the dynamic sequence of Scamp4 involvement in trafficking events

  • Computational modeling strategies:

    • Molecular dynamics simulations: Model Scamp4-membrane interactions based on structural data

    • Systems biology approaches: Develop mathematical models incorporating Scamp4 into larger trafficking networks

    • Machine learning approaches: Train predictive models using combined datasets to identify patterns not apparent through individual analyses

  • Visualization and integration tools:

    • Interaction network visualization: Use tools like Cytoscape to map Scamp4 into the broader interactome

    • Multi-dimensional data visualization: Employ dimensionality reduction techniques to identify patterns across multiple parameters

    • Pathway mapping: Integrate Scamp4 activities into established membrane trafficking pathways

  • Experimental validation of integrated models:

    • Design targeted experiments to test specific predictions from integrated models

    • Use orthogonal techniques to validate key findings from different methodological approaches

    • Employ perturbation studies to test the robustness of the developed models

  • Comparative analysis framework:

    • Compare integrated Scamp4 models with established models for other SCAMP family members

    • Identify conserved versus divergent mechanistic features across the family

    • Use evolutionary analysis to strengthen model interpretation

  • Data sharing and standardization:

    • Adopt standardized formats for sharing structural, functional, and interaction data

    • Contribute to public databases to facilitate meta-analyses across studies

    • Document analytical pipelines to ensure reproducibility

An example of successful integration would combine:

  • Structural data from techniques like those used for SCAMP1 (e.g., limited proteolysis, topology mapping)

  • Functional data from trafficking assays in cellular models

  • Interaction data from proteomics studies

  • Chemical response data from gene-chemical interaction studies

This multi-dimensional approach allows researchers to develop testable hypotheses about how Scamp4's unique structural features (particularly its lack of the extended N-terminal domain found in other SCAMPs) translate into functional specialization within the membrane trafficking machinery.

What are the most promising future research directions for understanding Scamp4 function in health and disease?

Several promising research directions exist for advancing our understanding of Scamp4 function in both normal physiology and disease states:

  • Tissue-specific roles and regulation:

    • Investigating cell type-specific functions of Scamp4 using conditional knockout models

    • Exploring regulatory mechanisms controlling Scamp4 expression in different tissues

    • Examining potential compensatory mechanisms between Scamp4 and other SCAMP family members

  • Disease associations and mechanisms:

    • Exploring potential roles in neurodegenerative diseases given the importance of membrane trafficking

    • Investigating connections to metabolic disorders through effects on hormone or nutrient transporter trafficking

    • Examining potential contributions to cancer progression through effects on cell surface receptor dynamics

  • Therapeutic targeting potential:

    • Developing small molecules or peptides targeting the conserved amphiphilic segments unique to SCAMPs

    • Exploring gene therapy approaches to modulate Scamp4 expression in diseases with trafficking defects

    • Using Scamp4 as a biomarker for environmental toxin exposure based on gene-chemical interaction data

  • Advanced structural biology:

    • Pursuing high-resolution structural studies of full-length Scamp4 in membrane environments

    • Using cryo-electron tomography to visualize Scamp4 in native cellular contexts

    • Employing structural prediction tools incorporating recent advances in AI-based protein structure prediction

  • Systems biology integration:

    • Developing comprehensive models of membrane trafficking incorporating Scamp4

    • Using multi-omics approaches to place Scamp4 in broader cellular networks

    • Employing computational models to predict effects of Scamp4 perturbation across various cellular processes

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.