Recombinant Rat Selenoprotein S (Sels)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
Selenos; Vimp; Selenoprotein S; SelS; Sg2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-190
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDRGEEPMSARPALETESLRFLHVTVGSLLASYGWYILFSCVLLYIVIQKLSLRLRALRQ RQLDQAEAVLEPDVVVKRQEALAAARLRMQEDLNAQVEKHKEKQRQLEEEKRRQKIEMWD SMQEGRSYKRNSGRPQEEDGPGPSTSSVIPKGKSDKKPLRGGGYNPLTGEGGGTCSWRPG RRGPSSGGUS
Uniprot No.

Target Background

Function
Selenoprotein S (Sels) is involved in the degradation of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol for proteasomal degradation via a ubiquitin-dependent pathway. Sels likely acts as a bridge between DERL1 (mediating retrotranslocation into the cytosol) and the VCP ATPase complex (mediating translocation and ubiquitination).
Gene References Into Functions
  1. Selenoprotein S Is Highly Expressed in the Blood Vessels and Prevents Vascular Smooth Muscle Cells From Apoptosis. PMID: 26058460
  2. Upregulation of Sels in astrocytes suggests a response to inflammatory stimuli. PMID: 23404306
  3. High hepatic Tanis mRNA expression correlates with insulin resistance development, potentially through SAA1 function. PMID: 19966530
Database Links
Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

Basic Research Questions

  • What is Selenoprotein S (Sels) and what are its key biological functions?

Selenoprotein S (Sels, also known as SelS, Vimp, or Sg2) is a selenocysteine-containing membrane protein primarily localized to the endoplasmic reticulum (ER). It plays several critical roles in cellular function:

  • Participates in the endoplasmic reticulum-associated degradation (ERAD) pathway for misfolded proteins

  • Functions as a linker between DERL1 (which mediates retrotranslocation of misfolded proteins) and the ATPase complex VCP

  • Provides protection against reactive oxidative species and oxidative stress

  • Involved in inflammatory response regulation

At the molecular level, Selenoprotein S transfers misfolded proteins from the ER to the cytosol, where they are degraded by the proteasome in a ubiquitin-dependent manner. This function makes it a valuable target for studying ER stress and protein quality control mechanisms .

  • What is the structural composition of Rat Selenoprotein S?

Rat Selenoprotein S has a unique structure with several key features:

  • Consists of 189 amino acids with a selenocysteine (Sec) residue at position 188

  • Contains a short segment in the ER lumen and an extended cytoplasmic region

  • The cytoplasmic segment includes a disordered segment (residues 123-189) containing the Sec residue

  • The Sec forms a selenenylsulfide bond with a nearby cysteine (Cys174)

  • Contains a coiled-coil region responsible for dimerization

  • Features a valosin-containing protein (VCP, p97) interacting motif

The cytosolic portion of the protein is classified as an intrinsically disordered protein (IDP), which typically adopts a stable tertiary structure only upon binding to its protein partners . This structural flexibility likely facilitates its multiple protein-protein interactions in the ERAD pathway.

  • What are the fundamental challenges in producing recombinant selenoproteins like Sels?

Production of recombinant selenoproteins presents several unique challenges:

  • Selenocysteine incorporation requires specialized translation machinery: Selenoproteins are translated via animal domain-specific elongation machinery that redefines UGA codons from termination to selenocysteine insertion .

  • Species barriers exist in selenoprotein synthesis: The natural genes encoding human selenoproteins are not compatible with the translation machinery in E. coli, making direct expression impossible .

  • Risk of premature termination: Protein translation is often prematurely terminated at the UGA codon due to its misreading as a stop codon, resulting in high ratios of truncated protein .

  • Selenocysteine position matters: Traditional recombinant expression methods typically only work when the Sec residue is located near the C-terminal end of the protein .

  • Separation challenges: For Selenoprotein S, separation of truncated and full-length Sec-containing forms is complicated by strong dimerization between truncated and full-length forms .

These challenges explain why many researchers have historically opted to study selenoprotein Cys-mutants rather than their native Sec-containing forms, despite the significant functional differences between these variants .

Advanced Research Questions

  • What are the optimal methods for expressing recombinant Rat Selenoprotein S in E. coli systems?

Based on successful strategies for other selenoproteins, the following methodological approach is recommended for Selenoprotein S expression:

ComponentRecommended ApproachRationale
Expression systemT7lac-driven pET vector systemShows better results than arabinose-inducible systems
UGA codon recodingEngineered bacterial-type SECIS elementEnables UGA readthrough in E. coli
Alternative approachUAG recoding in RF1-deficient strainRecent advance using complementary mutated bacterial tRNA^Sec
Co-expression plasmidpSUABC containing selA, selB, and selC genesProvides essential components for selenocysteine incorporation
Induction timingLate exponential phase (OD600 ~2.4)Significantly improves selenocysteine incorporation
Post-induction conditions24°C for 24 hoursOptimal for selenoprotein production
Media supplementationSodium selenite (1-10 μM)Provides selenium source for Sec incorporation

The expression approach should include:

  • Construction of the Selenoprotein S gene with an engineered SECIS element

  • Co-transformation with a plasmid containing selA (selenocysteine synthase), selB (elongation factor), and selC (tRNA for selenocysteine)

  • Growing cultures to late exponential phase before induction

  • Post-induction growth at lower temperature for extended periods

  • Implementation of specialized purification procedures to isolate Sec-containing forms

This strategy has yielded approximately 20 mg of selenoprotein per liter of bacterial culture with ~50% selenocysteine content for rat thioredoxin reductase, and could be adapted for Selenoprotein S .

  • How can one verify successful selenocysteine incorporation in recombinant Selenoprotein S?

Verifying selenocysteine incorporation requires a multi-method approach:

Analytical MethodApplicationInformation Provided
Mass spectrometryIntact protein analysisMass difference between full-length and truncated forms
LC-MS/MSPeptide mappingConfirmation of Sec-containing peptides
ICP-MSElemental analysisQuantification of selenium content
Activity assaysFunctional verificationComparison with Cys-mutant activity
Selective chemical labelingRedox state analysisVerification of Sec-specific reactivity
Western blottingExpression analysisDetection of full-length protein

A recent study on recombinant human glutathione peroxidases revealed an unexpected phenomenon in bacterial selenoprotein production systems: approximately 30% of recombinant selenoprotein products demonstrated one-codon skipping, resulting in the absence of a single amino acid at the position corresponding to the selenocysteine residue . This finding highlights the importance of comprehensive characterization of recombinant selenoproteins.

The methodology should include:

  • Careful extraction under reducing conditions to preserve Sec reactivity

  • Multiple analytical approaches to confirm Sec incorporation

  • Comparison with mutant forms (particularly Sec to Cys variants)

  • What purification strategies are most effective for isolating homogeneous recombinant Selenoprotein S?

Purification of Selenoprotein S presents unique challenges due to its membrane association, intrinsically disordered regions, and reactive selenocysteine residue. The following purification strategy is recommended:

Purification StepTechniquePurpose
Membrane extractionDetergent solubilizationRelease of membrane-bound SelS
Initial captureAffinity chromatographyIsolation of tagged protein
Selective enrichmentPhenylarsine oxide (PAO) agaroseSelective binding of Cys-Sec motifs
Additional purificationSize exclusion chromatographySeparation of oligomeric forms
Quality controlMass spectrometryVerification of Sec content

The PAO-agarose technique is particularly valuable as it works by binding vicinal Cys residues tightly. Since full-length Selenoprotein S contains a Cys-Sec motif, a large fraction of the truncated enzyme can be excluded using this chromatographic step .

Using an integrated expression and purification approach, researchers have achieved preparations of selenoproteins with >90% selenocysteine content and >95% purity . For Selenoprotein S specifically, additional considerations include:

  • Maintaining reducing conditions throughout purification to prevent oxidation of the Sec residue

  • Using N-terminal rather than C-terminal tags to avoid interfering with the C-terminal Sec residue

  • Including protease inhibitors to prevent degradation of disordered regions

  • Employing analytical techniques to verify the integrity of the selenenylsulfide bond

  • How can researchers effectively study the redox properties of the Cys-Sec motif in Selenoprotein S?

The selenenylsulfide bond between Cys174 and Sec188 in Selenoprotein S is central to its function. Studying this redox-active center requires specialized approaches:

TechniqueApplicationInformation Provided
Selective alkylationTrapping redox statesDifferentiation between reduced and oxidized forms
Spectroscopic methodsReal-time monitoringDetection of selenenylsulfide bond formation/reduction
Site-directed mutagenesisStructure-function analysisImpact of Cys174 or Sec188 mutations on activity
Redox potential determinationThermodynamic characterizationQuantification of redox properties
CrystallographyStructural analysisVisualization of different redox states

Based on insights from thioredoxin reductase studies, the selenenylsulfide bond in selenoproteins can undergo conformational changes upon reduction. In the oxidized state, the selenenylsulfide adopts a trans-configuration, while reduction leads to significant conformational changes that expose the selenol group for substrate interaction .

A methodological workflow would include:

  • Expression and purification of both wild-type and mutant (Sec188Cys) forms

  • Controlled oxidation/reduction of the purified protein

  • Trapping of specific redox states using alkylating agents

  • Structural and functional characterization of each redox state

  • Correlation between redox state and interaction with binding partners

  • What experimental approaches are recommended for studying Selenoprotein S interactions with ERAD pathway components?

Selenoprotein S interacts with multiple components of the ERAD machinery. Investigating these interactions requires:

ApproachTechniqueApplication
In vitro binding studiesSurface plasmon resonanceQuantification of binding affinities and kinetics
Cellular interaction analysisCo-immunoprecipitationIdentification of protein complexes in cellular context
Mapping interaction domainsTruncation/mutation analysisIdentification of specific binding regions
VisualizationFluorescence microscopyLocalization of interactions within cells
Structural characterizationCryo-electron microscopyStructural details of protein complexes

Research has shown that Selenoprotein S interacts with multiple partners including: Derlin-1 and 2 (components of the putative ERAD channel), p97/VCP (an AAA ATPase), Selenoprotein K, ubiquitin conjugation factor E4A (UBE4A), UBX domain-containing protein 8 (UBXD8), UBX domain-containing protein 6 (UBXD6), and kelch-containing protein 2 (KLHDC2) .

A comprehensive approach would involve:

  • Expression and purification of recombinant Selenoprotein S and its binding partners

  • In vitro reconstitution of complexes

  • Mutagenesis of key residues to map binding interfaces

  • Cellular studies to validate the physiological relevance of interactions

  • Correlation of binding with functional outcomes in the ERAD pathway

  • How does the intrinsically disordered nature of Selenoprotein S cytoplasmic domain affect experimental design considerations?

The intrinsically disordered cytoplasmic domain of Selenoprotein S (residues 123-189) presents unique experimental challenges:

ChallengeRecommended ApproachRationale
Structural heterogeneityNMR spectroscopy over X-ray crystallographyBetter suited for characterizing conformational ensembles
Proteolytic sensitivityLimited proteolysisMapping of disordered vs. structured regions
Expression difficultiesOptimized solubility tagsPrevention of aggregation during expression
Functional analysisDisorder-to-order transition studiesAssessment of structural changes upon partner binding
Computational predictionDisorder prediction algorithmsIdentification of potential binding motifs

Previous NMR spectroscopy characterization of a Selenoprotein S U188C mutant confirmed that the C-terminal domain is unstructured, classifying it as an intrinsically disordered protein . This property likely enables Selenoprotein S to interact with multiple partners through induced folding mechanisms.

Methodological approaches should include:

  • Careful design of expression constructs to maintain disorder

  • Implementation of stabilizing conditions during purification

  • Characterization of conformational dynamics using appropriate techniques

  • Analysis of structure acquisition upon binding to partners

  • Correlation between disorder and functional properties

  • What are the most effective model systems for studying Selenoprotein S function in oxidative stress responses?

Various model systems can be employed to study the role of Selenoprotein S in oxidative stress:

Model SystemApplicationAdvantages
Recombinant protein assaysDirect biochemical testingControl over experimental conditions
Cell culture modelsCellular function studiesAssessment in physiological context
Knockout/knockdown systemsLoss-of-function analysisEvaluation of essential functions
Animal modelsIn vivo functional studiesSystem-level understanding
Patient-derived samplesClinical relevanceTranslation to human disease

Recent research in zebrafish has provided valuable insights into selenoprotein function, demonstrating that knockouts of selenoprotein synthesis machinery components generate embryos that are sensitive to oxidative stress and express stress markers .

A comprehensive experimental approach would include:

  • Biochemical characterization of purified recombinant Selenoprotein S under oxidative conditions

  • Cell culture studies with varying Selenoprotein S expression levels

  • Analysis of cellular responses to different oxidative stressors

  • Evaluation of specific oxidative stress markers and signaling pathways

  • Validation in appropriate animal models

This multi-level approach allows researchers to connect molecular mechanisms to physiological outcomes and potential therapeutic applications in oxidative stress-related conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.