Recombinant Rat Sideroflexin-5 (Sfxn5)

Shipped with Ice Packs
In Stock

Description

Functional Role

Sfxn5 operates as a citrate transporter across mitochondrial membranes, influencing metabolic pathways:

  • Cytosolic citrate regulation: Maintains citrate levels required for acetyl-CoA and cholesterol synthesis .

  • Link to actin polymerization: Facilitates neutrophil spreading and migration via the citrate–cholesterol–PI(4,5)P₂ pathway .

  • No serine transport activity: Unlike other sideroflexins, Sfxn5 does not transport serine .

Table 2: Experimental Insights from Sfxn5 Studies

Model SystemMajor FindingsImplicationsSource
Sfxn5-deficient miceReduced neutrophil recruitment, impaired actin polymerization, and ROS productionLinks mitochondrial metabolism to immune cell motility
Citrate supplementationRescues actin defects and neutrophil spreadingConfirms citrate dependency of Sfxn5
Zebrafish morpholinoImpaired neutrophil migrationEvolutionary conservation of Sfxn5 function
In vitro liposomal assaysConfirmed citrate transport activityValidates direct transporter role

Mechanistic Pathway

Sfxn5’s role in neutrophil function involves:

  1. Citrate export from mitochondria to cytosol .

  2. Cholesterol synthesis via acetyl-CoA, enhancing phosphatidylinositol 4,5-bisphosphate (PI(4,5)P₂) levels at the plasma membrane .

  3. Actin polymerization driven by PI(4,5)P₂, enabling cell spreading and chemotaxis .

Applications in Research

  • Antibody validation: Anti-SFXN5 antibodies (e.g., ab172971) enable Western blot detection in human and rat tissues .

  • Disease models: Linked to combined oxidative phosphorylation deficiency 18 and metabolic disorders .

  • Therapeutic targeting: Potential for modulating immune responses or mitochondrial dysfunction .

Controversies and Limitations

  • Misidentified functions: Early studies mistakenly associated Sfxn1 with tricarboxylic acid transport due to co-purifying proteins .

  • Species-specific roles: Most functional data derive from mouse/zebrafish models; rat-specific mechanisms require further validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
Sfxn5; Sideroflexin-5; Tricarboxylate carrier BBG-TCC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-342
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sfxn5
Target Protein Sequence
MADTATTASAASAAASASNASSDAPPFQLGKPRFQQTSFYGRFRHFLDIIDPRTLFVTEK RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMSGYIPFGTP IVVGLLLPNQTLASTVFWQWLNQSHNACVNYANRNATKPSPASKFIQGYLGAVISAVSIA VGLNVLVQKANKFTPATRLLVQRFVPFPAVASANICNVVLMRYGELEEGIDVLDADGNLV GSSKIAARHALLETALTRVVLPMPILVLPPIVMSMLEKTALLQARPRLLLPVHSLVCLAA FGLALPLAISLFPQMSEIETSQLEPEIARATSSRTVVYNKGL
Uniprot No.

Target Background

Function
Recombinant Rat Sideroflexin-5 (Sfxn5) is a mitochondrial amino-acid transporter. It does not function as a serine transporter; it is unable to mediate serine transport into mitochondria. It transports citrate.
Gene References Into Functions
  1. Identification, functional characterization, and potential roles in brain biosynthesis and bioenergetics. PMID: 12150972
Database Links
Protein Families
Sideroflexin family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.
Tissue Specificity
Specifically expressed in the brain.

Q&A

What is the structural organization of rat Sfxn5 protein?

Rat Sideroflexin-5 (Sfxn5) belongs to the sideroflexin family of proteins characterized by a distinctive five-transmembrane (5TM) architecture. This unique structural feature places Sfxn5 in a specialized class of membrane proteins that represents only a small fraction of transmembrane proteins . The rat Sfxn5 protein shares significant structural homology with other sideroflexin family members, featuring conserved amino acid blocks across the transmembrane domains. Unlike many other membrane proteins, Sfxn5 lacks canonical mitochondrial targeting signals despite its mitochondrial localization . The protein is predominantly embedded in the inner mitochondrial membrane with a predicted molecular weight of approximately 37 kDa .

How does rat Sfxn5 compare to other sideroflexin family members?

Rat Sfxn5 is part of a family that includes several paralogues (Sfxn1-4). While all sideroflexins share the characteristic 5TM architecture, they exhibit distinct expression patterns and potentially specialized functions:

Sideroflexin MemberPrimary FunctionSequence Similarity to Sfxn1Notable Features
Sfxn1Mitochondrial serine transportReferenceAssociated with siderocytic anemia when mutated
Sfxn3Unknown79% similar, 70% identical to Sfxn1 Overlapping tissue expression with Sfxn1
Sfxn5Citrate transportLower similarity to Sfxn1More closely related to yeast homolog YOR271c

Unlike Sfxn1, which has been confirmed as a mitochondrial serine transporter , Sfxn5 functions primarily as a citrate transporter and does not transport serine into mitochondria . This functional divergence highlights the specialized roles that have evolved within this protein family.

What are the optimal approaches for expressing and purifying recombinant rat Sfxn5?

Successful expression and purification of recombinant rat Sfxn5 requires careful consideration of expression systems and purification strategies:

Expression Systems:

  • Saccharomyces cerevisiae: Effective for expressing Sfxn5 in its native mitochondrial environment. Studies have successfully expressed all five human sideroflexin proteins and yeast Sfxn in mitochondria of S. cerevisiae with subsequent purification to homogeneity .

  • Lactococcus lactis: Shown to be viable for expression of all human paralogues and yeast sideroflexin for subsequent zinc binding or transport studies .

  • E. coli: Can be used for producing non-folded protein for antibody generation but may not yield properly folded protein for functional studies.

Purification Protocol:

  • Express protein with appropriate tags (e.g., FLAG-tag) for affinity purification

  • Include cardiolipin in purification buffers, as it has been shown to be an important stabilizing factor for human Sfxn5

  • Use size exclusion chromatography to confirm proper folding and dimeric state

  • Verify protein stability using thermostability assays prior to functional testing

How can the functional activity of recombinant rat Sfxn5 be validated?

Validating the functional activity of recombinant rat Sfxn5 requires multiple complementary approaches:

Transport Assays:

  • Reconstitution into liposomes: Purified Sfxn5 can be incorporated into liposomes to measure direct citrate transport. This approach has been successfully used with recombinant SFXN1 for serine transport studies .

  • Isolated mitochondria: Compare citrate uptake in mitochondria isolated from wild-type versus Sfxn5-deficient cells to assess transport function.

Cellular Rescue Experiments:

  • Express sgRNA-resistant Sfxn5 cDNA in Sfxn5-null cells and measure restoration of citrate-dependent phenotypes, such as cholesterol synthesis and actin polymerization .

Thermostability Assays:

  • Use compound library screening with thermostability assays to identify specific binding partners that increase protein stability, which can help identify transport substrates .

What is the mechanism by which Sfxn5 regulates neutrophil spreading?

Sfxn5 plays a critical role in neutrophil spreading through a metabolic pathway involving citrate transport and subsequent cellular processes:

  • Citrate Transport: Sfxn5 maintains cytosolic citrate levels through mitochondrial transport

  • Metabolic Conversion: Citrate is converted to acetyl-CoA, a precursor for cholesterol synthesis

  • Cholesterol Production: Sufficient cholesterol levels are maintained for membrane function

  • PI(4,5)P2 Regulation: Cholesterol modulates phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) levels in the plasma membrane

  • Actin Polymerization: PI(4,5)P2 promotes actin polymerization, which is essential for neutrophil spreading

This pathway has been confirmed through rescue experiments in which exogenous supplementation with citrate or cholesterol partially reversed defects in PI(4,5)P2 levels, actin polymerization, and cell spreading in Sfxn5-deficient neutrophils .

How does Sfxn5 contribute to mitochondrial energy metabolism?

Sfxn5's role in mitochondrial energy metabolism is multifaceted:

Citrate Transport: As a citrate transporter, Sfxn5 facilitates the movement of this key tricarboxylic acid (TCA) cycle intermediate across the mitochondrial membrane . This transport function impacts:

  • Energy Production: Citrate is a critical metabolite in the TCA cycle, which generates reducing equivalents for oxidative phosphorylation

  • Lipid Metabolism: Cytosolic citrate serves as a source of acetyl-CoA for fatty acid and cholesterol synthesis

  • Thermogenesis Regulation: In brown adipose tissue, Sfxn5 plays a role in the regulation of UCP1-dependent thermogenesis by supporting mitochondrial glycerol-3-phosphate utilization

These functions position Sfxn5 as an important link between mitochondrial energy production and cytosolic metabolic processes.

What experimental approaches are recommended for investigating Sfxn5's role in disease models?

Investigating Sfxn5 in disease models requires specialized approaches depending on the research focus:

Genetic Manipulation Strategies:

  • siRNA/morpholino: Effective for achieving Sfxn5 deficiency in cellular and animal models. Studies have successfully used both siRNA transfection in mice and morpholino injection in zebrafish to study neutrophil recruitment .

  • CRISPR/Cas9: For generating stable knockout cell lines or animal models with complete Sfxn5 deletion.

  • Conditional knockout: Tissue-specific or inducible deletion to study temporal and spatial requirements for Sfxn5.

Disease-Specific Models:

  • Inflammatory Disorders: Given Sfxn5's role in neutrophil function, models of inflammatory diseases are particularly relevant. Neutrophil recruitment assays in both mice and zebrafish have been used successfully .

  • Metabolic Disorders: As Sfxn5 affects cellular metabolism through citrate transport, metabolic disease models may reveal additional functions.

  • Neurodegenerative Diseases: The GeneCards database indicates associations between SFXN5 and Parkinson's Disease , suggesting relevance to neurodegeneration models.

Functional Readouts:

  • Cell spreading and adhesion assays

  • Chemotaxis measurements

  • ROS production quantification

  • Actin polymerization analysis

  • Metabolomic profiling of citrate, acetyl-CoA, and cholesterol

How can researchers dissect the specific contribution of Sfxn5 from other sideroflexin family members in cellular processes?

Distinguishing the specific functions of Sfxn5 from other sideroflexins requires targeted approaches:

Paralog-Specific Experimental Design:

  • Expression profiling: Analyzing tissue-specific expression patterns can help identify contexts where Sfxn5 is the predominant family member. Northern blot analysis has shown partially overlapping expression patterns among family members .

  • Synthetic lethality screening: Identifying genetic interactions where combined deficiency of Sfxn5 and another family member produces enhanced phenotypes. This approach has revealed that SFXN3 emerged as one of the top synthetic lethal genes with SFXN1 in the absence of exogenous glycine .

  • Transport substrate specificity:

    • Sfxn1: Confirmed serine transporter

    • Sfxn5: Citrate transporter, not a serine transporter

    • These functional differences can be exploited to distinguish their roles

  • Rescue experiments: Determining whether other family members can complement Sfxn5 deficiency provides insight into functional redundancy.

Biochemical Differentiation:

  • Liposome-reconstitution studies: Comparing transport activities of purified proteins for different substrates

  • Binding partner identification: Using approaches like co-immunoprecipitation to identify unique protein interactions

What structural features determine Sfxn5's substrate specificity?

The structural determinants of Sfxn5's substrate specificity remain an active area of investigation, but several important features have been identified:

Key Structural Elements:

  • Transmembrane domains: The arrangement of the five transmembrane regions creates a channel or pore through which specific metabolites can pass .

  • Conserved amino acid residues: Certain amino acid blocks are highly conserved across the sideroflexin family but vary between individual members, potentially accounting for differences in substrate specificity .

  • Metal binding sites: Human Sfxn5 has been shown to bind zinc ions, which could influence transport capability or substrate specificity .

Studies utilizing scanning alanine mutagenesis combined with thermostability assays have been employed to identify zinc binding sites in human Sfxn5 . Similar approaches could be used to identify amino acid residues critical for citrate binding and transport in rat Sfxn5.

What techniques are most effective for studying the oligomeric state and protein-protein interactions of rat Sfxn5?

Understanding the oligomeric state and interaction partners of rat Sfxn5 requires specialized biophysical and biochemical approaches:

Oligomeric State Determination:

  • Size exclusion chromatography: Effective for determining if Sfxn5 exists as a monomer, dimer, or higher-order oligomer. Human Sfxn5 has been shown to exist as a dimer in detergent solution under stabilizing conditions that include cardiolipin .

  • Native mass spectrometry: Can provide accurate mass measurements of intact protein complexes to confirm oligomeric state.

  • Cross-linking coupled with mass spectrometry: Helps identify regions involved in dimerization or oligomerization.

Protein-Protein Interaction Analysis:

  • Co-immunoprecipitation: Using antibodies against Sfxn5 to pull down interaction partners from mitochondrial extracts.

  • Proximity labeling: Techniques such as BioID or APEX can identify proteins in close proximity to Sfxn5 within the mitochondrial membrane.

  • Yeast two-hybrid screening: Modified for membrane proteins to identify potential interaction partners.

  • Förster resonance energy transfer (FRET): Has been applied to study potential interactions of sideroflexins with compounds like hemin .

How has Sfxn5 function evolved across species, and what are the implications for using rat models?

Evolutionary analysis of sideroflexins provides important context for interpreting results from rat models:

Evolutionary Conservation:
The sideroflexin family is highly conserved throughout eukaryotes, with homologs identified in diverse organisms:

  • Caenorhabditis elegans: Seven homologous genes

  • Drosophila melanogaster: Two homologous genes

  • Saccharomyces cerevisiae: One homologous gene (YOR271c)

  • Mammals: Five sideroflexin family members (Sfxn1-5)

Mouse Sfxn5 is more closely related to the yeast homolog YOR271c than to mouse Sfxn1 , suggesting functional conservation of certain aspects over evolutionary time.

Implications for Rat Models:

  • Functional conservation: The high sequence conservation suggests that findings in rat models may translate to human biology.

  • Expression pattern differences: Northern blot analysis has shown partially overlapping patterns of expression across family members , which may vary between species.

  • Model validation: When using rat models, researchers should confirm that the expression pattern and regulation of Sfxn5 in the tissue of interest mirrors that in humans.

What experimental approaches best leverage cross-species comparisons to understand Sfxn5 function?

Cross-species experimental approaches can provide valuable insights into conserved and divergent functions of Sfxn5:

Complementation Studies:

  • Express human SFXN5 in Sfxn5-deficient rat cells to determine functional conservation

  • Test if yeast YOR271c can complement Sfxn5 deficiency in mammalian cells

Evolutionary Biochemistry:

  • Compare substrate specificity of purified Sfxn5 proteins from different species

  • Identify conserved vs. divergent amino acid residues and test their functional significance through targeted mutagenesis

Model Organism Advantages:

  • Zebrafish: Neutrophil recruitment has been successfully studied using morpholino-based Sfxn5 knockdown

  • Yeast: The single sideroflexin homolog simplifies functional studies without paralog redundancy

  • Mice/Rats: Closer to human physiology, allowing investigation of tissue-specific functions

What are the common technical challenges in working with recombinant rat Sfxn5, and how can they be addressed?

Working with membrane proteins like Sfxn5 presents several technical challenges:

Expression and Solubilization:

  • Challenge: Low expression levels and protein misfolding
    Solution: Optimize expression conditions in systems like Saccharomyces cerevisiae that correctly target Sfxn5 to mitochondria

  • Challenge: Maintaining protein stability during solubilization
    Solution: Include cardiolipin in purification buffers, as it has been shown to be an important stabilizing factor for human Sfxn5

Functional Assays:

  • Challenge: Distinguishing specific transport activity from non-specific effects
    Solution: Use proper controls including heat-inactivated protein and closely related family members with different substrate specificities

  • Challenge: Low signal-to-noise ratio in transport assays
    Solution: Optimize reconstitution conditions and develop sensitive detection methods for transported substrates

Antibody Specificity:

  • Challenge: Cross-reactivity with other sideroflexin family members
    Solution: Validate antibodies using knockout controls and consider raising antibodies against unique peptide sequences

How can researchers troubleshoot inconsistent results when studying Sfxn5's metabolic effects?

Inconsistent results when studying Sfxn5's metabolic effects can stem from several sources:

Common Sources of Variability:

  • Cell type and metabolic state: Sfxn5 function may vary depending on the metabolic requirements and status of different cell types

  • Compensatory mechanisms: Other sideroflexin family members may partially compensate for Sfxn5 deficiency

  • Culture conditions: Nutrient availability in culture media can mask or exacerbate Sfxn5-dependent phenotypes

Troubleshooting Approaches:

  • Comprehensive knockdown/knockout validation: Confirm thorough depletion of Sfxn5 at both mRNA and protein levels

  • Media composition control: Systematically vary media components, particularly those that impact relevant metabolic pathways:

    • Serine depletion has been shown to reveal phenotypes in SFXN1-deficient cells

    • Citrate supplementation can rescue certain phenotypes in Sfxn5-deficient cells

  • Temporal analysis: Monitor metabolic changes over time, as compensatory mechanisms may develop

  • Combined knockdown: Simultaneously target multiple sideroflexin family members to overcome functional redundancy

  • Metabolomic profiling: Use targeted and untargeted metabolomics to comprehensively assess metabolic changes rather than focusing on single pathways

What are the most promising avenues for future research on rat Sfxn5?

Several promising research directions could significantly advance our understanding of Sfxn5:

  • Structural biology: Determining the high-resolution structure of Sfxn5 would provide crucial insights into its transport mechanism and substrate specificity.

  • Tissue-specific functions: Investigating Sfxn5's role in different tissues, particularly:

    • Brown adipose tissue, where it may regulate UCP1-dependent thermogenesis

    • Immune cells, where it affects neutrophil spreading and function

    • Neuronal tissues, given the association with Parkinson's Disease

  • Metabolic regulation: Exploring how Sfxn5 activity is regulated in response to changing metabolic demands and cellular stress.

  • Additional transport substrates: While citrate is a confirmed substrate, Sfxn5 may transport other related metabolites that have not yet been identified.

  • Potential therapeutic targeting: Developing approaches to modulate Sfxn5 activity could have applications in inflammatory disorders given its role in neutrophil function.

How might emerging technologies enhance our understanding of Sfxn5 biology?

Emerging technologies offer new opportunities to advance Sfxn5 research:

Cryo-electron microscopy: Could provide structural insights into Sfxn5's transmembrane organization and transport mechanism at near-atomic resolution.

Single-cell metabolomics: Would allow analysis of how Sfxn5 affects metabolite levels with cellular resolution, revealing cell-type specific effects.

Genome-wide CRISPR screens: Could identify genetic interactions and pathways connected to Sfxn5 function.

Optogenetic control: Development of light-activated Sfxn5 variants could enable temporal control of citrate transport to study downstream metabolic effects.

Spatial metabolomics: Techniques like MALDI imaging mass spectrometry could reveal how Sfxn5 influences metabolite distribution within tissues.

Protein engineering: Designing Sfxn5 variants with altered substrate specificity could help dissect the relationship between transport activity and cellular phenotypes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.