Recombinant Rat Smoothened homolog (Smo)

Shipped with Ice Packs
In Stock

Description

Introduction to Smoothened (Smo) Protein

Smoothened (Smo) is a crucial protein in the Hedgehog signaling pathway, which plays a pivotal role in embryonic development and adult tissue homeostasis. It is a Class Frizzled G protein-coupled receptor (GPCR) that transduces signals from Hedgehog morphogens across cell membranes . The recombinant rat Smoothened homolog (Smo) refers to a genetically engineered version of this protein derived from rat sources, designed for research purposes to study its function and signaling mechanisms.

Structure and Function of Smoothened

Smo is a 7-transmembrane protein that, when activated by Hedgehog signaling, leads to the stabilization of Gli transcription factors, which in turn regulate gene expression . The structure of Smo suggests interactions with heterotrimeric G proteins, although the extent of this interaction in Hedgehog signaling remains a topic of debate . Smo can be activated through lipid binding and ligand interactions, leading to both G protein-dependent and independent signaling pathways .

Research Findings and Applications

Research on Smo has highlighted its role as a key target in cancer therapy, particularly in Hedgehog pathway-driven cancers. Mutations in Smo leading to its overactivation are associated with various cancers, including skin and brain cancers . Therapeutic agents like vismodegib target Smo to inhibit Hedgehog signaling in cancer treatment .

Table: Key Features of Smoothened (Smo) Protein

FeatureDescription
Protein TypeG protein-coupled receptor (GPCR)
FunctionTransduces Hedgehog signals across cell membranes
Role in CancerOveractivation associated with various cancers
Therapeutic TargetTargeted by drugs like vismodegib for cancer treatment
Signaling MechanismsBoth G protein-dependent and independent pathways

Post-Translational Modifications and Regulation

Smo activity is regulated by post-translational modifications such as phosphorylation, ubiquitination, and lipid binding. Phosphorylation of the C-terminal tail is crucial for Smo activation and its localization to the primary cilium . Additionally, Smo interacts with proteins like β-arrestin and G12, further complicating its signaling mechanisms .

Table: Post-Translational Modifications of Smoothened

ModificationEffect on Smo Activity
PhosphorylationEssential for activation and localization
UbiquitinationRegulates endocytosis and degradation
Lipid BindingInduces active conformation

Challenges and Future Directions

Despite advancements in understanding Smo's role in cancer, drug resistance remains a significant challenge. Further research into Smo's regulation and signaling pathways could provide insights into novel therapeutic strategies. Identifying how Patched (Ptc) inhibits Smo endogenously could also reveal new targets for therapy .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Smo; Smoh; Smoothened homolog; SMO
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
31-793
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Smo
Target Protein Sequence
RGAALSGNVTGPGPRSAGGSARRNAPVTSPPPPLLSHCGRAAHCEPLRYNVCLGSALPYG ATTTLLAGDSDSQEEAHSKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTL CQATRGPCAIVERERGWPDFLRCTPDHFPEGCPNEVQNIKFNSSGQCEAPLVRTDNPKSW YEDVEGCGIQCQNPLFTEAEHQDMHSYIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVI LFYVNACFFVGSIGWLAQFMDGARREIVCRADGTMRFGEPTSSETLSCVIIFVIVYYALM AGVVWFVVLTYAWHTSFKALGTTYQPLSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSV SGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIKSNHPGLLSEKAASKIN ETMLRLGIFGFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKKPIPD CEIKNRPSLLVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGHSDDEPKRIKKS KMIAKAFSKRRELLQNPGQELSFSMHTVSHDGPVAGLAFELNEPSADVSSAWAQHVTKMV ARRGAILPQDVSVTPVATPVPPEEQANLWLVEAEISPELEKRLGRKKKRRKRKKEVCPLG PAPELHHSAPVPATSAVPRLPQLPRQKCLVAANAWGTGEPCRQGAWTVVSNPFCPEPSPH QDPFLPGASAPRVWAQGRLQGLGSIHSRTNLMEAELLDADSDF
Uniprot No.

Target Background

Function

Smoothened (Smo) is a G protein-coupled receptor that likely interacts with the patched protein (PTCH) to mediate hedgehog signaling. Sonic hedgehog (SHH) binding to PTCH is believed to relieve PTCH's inhibition of Smo. Smo is crucial for the ciliary accumulation of KIF7, GLI2, and GLI3. It interacts with DLG5 at the ciliary base, promoting the accumulation of KIF7 and GLI2 at the ciliary tip, leading to GLI2 activation.

Gene References Into Functions
  1. This study details the cardiomyocyte transcriptional response to Shh and highlights the critical role of Smo-Gi coupling in hedgehog signaling within normal and ischemic myocardium. PMID: 24816261
  2. Fluoride increases Shh, Smo, and Gli1 expression (protein and mRNA) in rat hepatocytes with chronic fluorosis; cyclopamine inhibits this effect. PMID: 24388991
  3. Ptch1 and Smo are predominantly localized postsynaptically, mirroring the distribution in hippocampal neurons. PMID: 22477363
  4. In young rat hippocampal neurons, Smo is found in processes and growth cones; in mature neurons, it primarily resides in dendrites, spines, and postsynaptic sites. PMID: 21618238
  5. Ocular hypertension upregulates Shh and Smo in retinas; Shh exhibits neuroprotective effects on retinal ganglion cells in a rat hypertension model. PMID: 20071678
  6. Facial nerve axotomy upregulates Shh and Smo in adult rat facial motor neurons, but not in neonates. PMID: 15356205
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.
Tissue Specificity
In embryo, found in the early neural folds and neural tube, pre-somitic mesoderm and somites, developing limb bud, gut, eye, testes, cartilage, muscle, lung, epiglottis, thymus, tongue, jaw, taste buds, teeth, and skin. In adult, found in multiple tissues

Q&A

How does rat Smoothened compare structurally to human Smoothened?

Rat Smoothened protein shares significant structural and functional homology with the human version, making it a valuable research model. Both proteins contain seven transmembrane domains characteristic of GPCRs, with conserved functional regions including the extracellular cysteine-rich domain (CRD) that can bind to small molecules, the transmembrane core that undergoes conformational changes during activation, and intracellular loops that interact with downstream effectors. While the core functional domains are highly conserved between species (approximately 91-94% sequence identity), species-specific variations exist in certain regulatory regions. These differences may impact specific protein-protein interactions, post-translational modifications, and potentially the binding affinities of certain small molecule modulators. Researchers should account for these species-specific differences when translating findings between rat models and human applications.

What are the recommended storage conditions for recombinant rat Smoothened protein?

For optimal stability and activity maintenance of recombinant rat Smoothened protein, storage at -20°C is recommended. To avoid protein degradation caused by repeated freeze-thaw cycles, the protein should be aliquoted into single-use volumes before freezing. When stored properly, the protein should maintain stability until the expiration date indicated on the vial. During shipping, the protein can be transported at ambient temperature, but upon arrival, it should be immediately transferred to -20°C for long-term storage. Some protocols may require storage at -80°C for extended periods, but standard research applications typically find -20°C sufficient for maintaining protein integrity. Always verify the concentration upon reconstitution as specified on the product label or certificate of analysis.

What detection methods are typically used for studying rat Smoothened protein expression?

Western blotting is the most commonly employed method for detecting rat Smoothened protein expression in tissue or cell lysates. This approach typically uses specific polyclonal or monoclonal antibodies that recognize epitopes in the Smoothened protein. Immunofluorescence and immunohistochemistry techniques provide valuable information about Smoothened's subcellular localization, especially its trafficking between primary cilia and the cell membrane during activation. Flow cytometry can be employed for quantitative analysis of Smoothened expression in cell populations. For gene expression analysis, quantitative PCR (qPCR) remains the standard approach for measuring Smoothened mRNA levels. When selecting antibodies for detection, researchers should verify cross-reactivity with rat Smoothened specifically, as some antibodies may be optimized for human or mouse variants. Brain tissue often serves as a positive control for Smoothened detection experiments.

How do mutations in rat Smoothened affect its function in Hedgehog signaling pathways?

Mutations in Smoothened can dramatically alter its function in Hedgehog signaling, often resulting in constitutive activation or inhibition. Analogous to the human somatic mutations identified in basal cell carcinoma (D473→H473 and R562→Q562), similar mutations in rat Smoothened can render the protein constitutively active independent of Hedgehog ligand stimulation. These gain-of-function mutations typically affect the transmembrane domains or intracellular loops, disrupting the autoinhibitory conformation of Smoothened. Conversely, loss-of-function mutations may prevent appropriate trafficking to the primary cilium or disrupt interaction with downstream effectors like Gli transcription factors. When designing experiments involving mutated Smoothened proteins, researchers should conduct careful validation studies to confirm the expected functional outcomes, as some mutations may have species-specific effects between rat and human models. Characterization should include assessment of ciliary localization, Gli activation, and interaction with known binding partners to fully understand how specific mutations affect signaling dynamics.

What methodological approaches are most effective for studying Smoothened interactions with the Patched protein?

To effectively study the interaction between rat Smoothened and Patched proteins, multiple complementary methodologies should be employed. Co-immunoprecipitation (Co-IP) assays can identify physical interactions between these proteins, though the hydrophobic nature of both proteins makes this technically challenging and requires careful optimization of detergent conditions. Proximity ligation assays (PLA) provide a sensitive method for detecting protein interactions in situ with spatial resolution. FRET (Förster Resonance Energy Transfer) or BRET (Bioluminescence Resonance Energy Transfer) approaches offer real-time analysis of protein interactions and conformational changes. For functional analysis, researchers should complement physical interaction studies with downstream signaling assays, such as Gli reporter assays, which measure transcriptional outputs of the pathway. Advanced approaches such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or crosslinking mass spectrometry (XL-MS) can provide detailed structural information about interaction interfaces. When designing these experiments, it's crucial to include appropriate controls, such as known Smoothened mutations that disrupt Patched binding, to validate the specificity of observed interactions.

How does the integrin/ILK/Rac-1 pathway interact with Smoothened-mediated signaling in vascular smooth muscle cells?

Recent evidence suggests significant crosstalk between the integrin/ILK/Rac-1 pathway and Smoothened-mediated signaling in vascular smooth muscle cells (VSMCs), particularly in the context of vascular injury and remodeling. In experimental models of subarachnoid hemorrhage (SAH), there appears to be a functional relationship between these pathways that affects VSMC phenotypic transformation. When recombinant osteopontin (rOPN) is administered, it prevents the changes in marker proteins of vascular smooth muscle phenotypic transformation, specifically maintaining α-smooth muscle actin levels and preventing increases in embryonic smooth muscle myosin heavy chain (SMemb). These protective effects are abolished by integrin receptor antagonists (GRGDSP), integrin-linked kinase (ILK) siRNA, and Rac-1 inhibitors (NSC23766), suggesting that Smoothened signaling may converge with or be modulated by the integrin receptor/ILK/Rac-1 pathway. Methodologically, researchers investigating this interaction should employ both in vitro models using cultured VSMCs and in vivo models that allow assessment of vascular function and structure. Measurement of active Rac-1 levels, ILK expression and activity, and downstream phenotypic markers provides critical information about pathway interactions.

What are the considerations for designing experiments to study Smoothened trafficking to primary cilia?

Studying Smoothened trafficking to primary cilia requires careful experimental design and specialized techniques. Live-cell imaging using fluorescently tagged rat Smoothened constructs provides the most direct visualization of trafficking dynamics, though care must be taken to ensure tags don't interfere with protein function. Fixed-cell immunofluorescence approaches offer higher resolution snapshots of localization at specific timepoints, requiring co-staining with ciliary markers (such as acetylated tubulin or Arl13b). Super-resolution microscopy techniques (STED, STORM, or PALM) can provide nanoscale detail about Smoothened distribution within the cilium. When designing these experiments, researchers should consider the cell type carefully - not all cell lines form primary cilia efficiently, with NIH3T3 fibroblasts and IMCD3 cells being commonly used models. Serum starvation (12-24 hours) is typically required to induce ciliogenesis before Smoothened trafficking can be assessed. Pathway activators (Smoothened agonists or Sonic Hedgehog) and inhibitors (cyclopamine, vismodegib) serve as important positive and negative controls. For quantitative analysis, automated image analysis tools that measure Smoothened enrichment in cilia relative to the plasma membrane provide the most objective assessment of trafficking efficiency.

What is the recommended protocol for analyzing Smoothened-dependent gene expression changes?

For comprehensive analysis of Smoothened-dependent gene expression changes, a multi-step approach is recommended. Begin with RNA-seq or microarray analysis to capture genome-wide expression changes following Smoothened activation or inhibition in your rat model system. This should be complemented with targeted qRT-PCR validation of key genes identified in the high-throughput screening. Time-course experiments are essential, as Hedgehog pathway activation leads to both immediate-early gene responses and delayed secondary transcriptional events. For dissecting direct versus indirect targets, incorporate chromatin immunoprecipitation sequencing (ChIP-seq) for Gli transcription factors, the primary transcriptional mediators downstream of Smoothened. Control experiments should include pathway activation using SAG (Smoothened Agonist) and inhibition using cyclopamine or other Smoothened antagonists. For in vivo studies, tissue-specific conditional activation or knockout models provide the most physiologically relevant context. Analysis should focus on established Hedgehog target genes (Ptch1, Gli1) as positive controls, while also identifying tissue-specific or context-dependent gene regulation patterns.

How should researchers design experiments to evaluate the efficacy of Smoothened antagonists in rat models?

When evaluating Smoothened antagonists in rat models, experimental design should comprehensively assess both target engagement and downstream functional outcomes. For target engagement, researchers should measure direct binding of compounds to rat Smoothened using techniques such as thermal shift assays or competitive binding assays. Ciliary trafficking assays provide a functional readout of antagonist activity, as Smoothened inhibition prevents its accumulation in primary cilia. Gli reporter assays in rat cells quantify pathway inhibition at the transcriptional level. For in vivo efficacy, study designs should include dose-response relationships, pharmacokinetic analyses to confirm appropriate exposure levels, and pharmacodynamic endpoints measuring Gli1 and Ptch1 expression in target tissues. Control groups should include vehicle treatment, as well as a reference antagonist with established activity. When translating between species, researchers should account for potential differences in drug metabolism and target binding affinities between rat and human Smoothened. The table below summarizes key parameters for antagonist evaluation:

ParameterMeasurement MethodConsiderations
Target BindingThermal shift assay, competition bindingConfirm binding to rat Smoothened specifically
Pathway InhibitionGli reporter assay, qPCR of target genesIC50 determination in rat cells
Cellular PhenotypeProliferation, differentiation assaysCell type-specific outcomes
In vivo PK/PDLC-MS/MS, target gene expressionTissue distribution, target engagement
Functional OutcomeModel-specific endpointsDisease-relevant measurements

What controls are essential when conducting functional studies of recombinant rat Smoothened?

Rigorous controls are essential for ensuring the validity and interpretability of functional studies involving recombinant rat Smoothened. Positive controls should include known Smoothened activators such as SAG (Smoothened Agonist) or purmorphamine, which directly bind and activate Smoothened independent of upstream pathway components. Negative controls should include specific Smoothened antagonists like cyclopamine or vismodegib, as well as upstream pathway inhibition (e.g., using robotnikinin to block Sonic Hedgehog). Vehicle controls are critical for both in vitro and in vivo experiments to account for potential carrier effects, particularly when using DMSO or other organic solvents for compound delivery. When using overexpression systems, both wild-type Smoothened and known mutant variants (constitutively active and inactive) should be included as reference points. For knockdown or knockout studies, rescue experiments with recombinant Smoothened provide essential validation of specificity. Tissue or cell type controls are important when evaluating pathway responses, as Hedgehog pathway components and sensitivity vary significantly across different biological contexts. Time course controls help distinguish direct versus indirect effects, particularly for transcriptional responses where secondary effects may emerge hours after initial pathway activation.

What experimental approaches can be used to study the role of Smoothened in vascular smooth muscle phenotypic transformation?

To investigate Smoothened's role in vascular smooth muscle phenotypic transformation, researchers should employ multiple complementary approaches. In vitro studies using primary rat vascular smooth muscle cells (VSMCs) provide a controlled environment for mechanistic investigations. These cells can be subjected to phenotypic modulation through various stimuli (e.g., PDGF-BB for synthetic phenotype, TGF-β for contractile phenotype), with concurrent Smoothened activation or inhibition. Key phenotypic markers to assess include α-smooth muscle actin (decreased in synthetic phenotype) and embryonic smooth muscle myosin heavy chain (SMemb, increased in synthetic phenotype). For in vivo models, the subarachnoid hemorrhage (SAH) model in rats provides relevant pathophysiological context, as it induces vascular smooth muscle phenotypic transformation that can be modified by pathway interventions. When manipulating Smoothened activity, both genetic approaches (siRNA knockdown, CRISPR/Cas9 editing) and pharmacological methods (specific agonists/antagonists) should be employed for cross-validation. Advanced techniques including time-lapse imaging of cellular morphology changes, contractility assays, and single-cell transcriptomics provide deeper insights into phenotypic transformation dynamics. Analysis should focus on both morphological changes (cell shape, stress fiber organization) and molecular signatures (contractile protein expression, ECM production).

How can researchers address solubility issues when working with recombinant Smoothened protein?

Smoothened presents significant solubility challenges due to its seven transmembrane domains and hydrophobic regions. To overcome these issues, researchers should optimize buffer conditions by including appropriate detergents at concentrations above their critical micelle concentration (CMC). Non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) at 0.1-0.5%, CHAPS at 0.5-1%, or Digitonin at 0.5-1% are commonly used for Smoothened solubilization. Additionally, incorporating lipids such as cholesterol or phospholipids into the buffer can enhance stability of the solubilized protein. For expression systems, insect cells (Sf9, High Five) often yield better-folded Smoothened protein compared to bacterial systems. Utilizing fusion partners like MBP (maltose-binding protein) or SUMO can improve solubility during recombinant expression. When purifying Smoothened, gradient elution with mild detergent conditions helps maintain protein integrity and functional conformation. If aggregation occurs during concentration steps, reducing the concentration rate and keeping samples at 4°C can minimize this issue. For functional studies, reconstitution into nanodiscs or liposomes provides a more native-like lipid environment that can improve protein stability and activity compared to detergent micelles alone.

What strategies can overcome inconsistent results in Smoothened-focused signaling assays?

Inconsistent results in Smoothened signaling assays typically stem from several common issues that can be systematically addressed. First, ensure consistent cell culture conditions, as Hedgehog pathway activity is highly sensitive to cell density, serum levels, and passage number. Standardize protocols for cell seeding density (typically 60-70% confluence for optimal responsiveness) and serum starvation (16-24 hours) before pathway stimulation. Second, verify the integrity of your recombinant Smoothened protein through activity assays before each experimental series. Third, minimize variation in transfection efficiency by using stable cell lines rather than transient transfections when possible. For Gli reporter assays, use dual-luciferase systems with appropriate normalization controls. The timing of measurements is critical—Gli1/Ptch1 transcriptional responses typically peak 24-48 hours after pathway activation, so consistent time points are essential. When working with primary cells, batch-to-batch variation can be significant; therefore, pool multiple isolations or use internal normalization strategies. For pharmacological modulators, prepare fresh working solutions for each experiment as many Smoothened modulators have limited stability in aqueous solutions. Finally, include comprehensive controls in each experiment as described in question 3.3 to enable troubleshooting of inconsistent results.

What are the critical factors for successful co-immunoprecipitation of Smoothened with interacting partners?

Successful co-immunoprecipitation (Co-IP) of Smoothened with its interacting partners requires careful optimization of several critical parameters. The choice of lysis buffer is paramount—standard RIPA buffers often disrupt the membrane-protein interactions of Smoothened. Instead, use milder lysis conditions with buffers containing 1% NP-40 or 1% Digitonin, supplemented with 150-300 mM NaCl and 5% glycerol to maintain protein-protein interactions. Pre-clearing the lysate with protein A/G beads for 1 hour at 4°C reduces non-specific binding. For antibody selection, epitope accessibility is crucial—antibodies recognizing intracellular loops or the C-terminus of Smoothened typically perform better than those targeting transmembrane regions. Crosslinking approaches using membrane-permeable crosslinkers like DSP (dithiobis(succinimidyl propionate)) prior to lysis can stabilize transient interactions. Incubation conditions should be optimized for each interacting partner, but generally, overnight incubation at 4°C with gentle rotation yields best results. For elution, native conditions using excess competing peptide may preserve complex integrity better than boiling in SDS buffer. When analyzing results, reciprocal Co-IPs (pulling down the partner and blotting for Smoothened) provide important validation. Finally, include appropriate negative controls, such as IgG matching the host species of the immunoprecipitating antibody and lysates from cells not expressing one of the interaction partners.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.