Recombinant Rat Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

  • Ion Homeostasis: Maintains electrochemical gradients for osmoregulation, nerve transmission, and muscle contraction .

  • Disease Links: Associated with hypertension, heart failure, and neurological disorders .

  • Cell Signaling: Enhances TRAF3/6 ubiquitination and TAK1/TBK1 phosphorylation in innate immunity .

Research Applications

Recombinant Atp1b1 is widely used in:

  • Antibody Validation: Serves as an immunogen for antibodies in Western blot (WB), ELISA, and immunohistochemistry (IHC) .

  • ELISA Kits: Quantifies Atp1b1 in biological fluids (sensitivity: 0.057 ng/mL; range: 0.16–10 ng/mL) .

  • Gene Therapy: Adenoviral overexpression improves alveolar fluid clearance in rat models of pulmonary edema .

Therapeutic Potential in Pulmonary Edema

Study ModelOutcomeSource
Rat Lungs (Elevated LAP)Atp1b1 overexpression increased Na+/K+-ATPase activity by 35–45%, restoring alveolar fluid clearance
Hypoxic PostconditioningAtp1b1 interaction with Neuroglobin (Ngb) enhanced neuroprotection after cerebral ischemia

Mechanistic Insights

  • Membrane Trafficking: Atp1b1 recruits α-subunits to the basolateral membrane in epithelial cells .

  • Protein Interactions: Binds Neuronal Growth Regulator 1 (NEGR1) in lipid rafts, implicating roles in obesity and mental disorders .

Future Directions

  • Gene Therapy: Optimizing adenoviral delivery for heart failure models .

  • Neurological Studies: Exploring Atp1b1-Ngb interactions in stroke recovery .

  • Structural Biology: Resolving 3D conformations of α/β heterodimers .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format readily available in our inventory. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Atp1b1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-304
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGSMPSEPKERGEFNHERGERKVCRFKLDWLGNCSGLNDESYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPLTMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGFYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTLDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Uniprot No.

Target Background

Function
This is the non-catalytic component of the active enzyme that catalyzes ATP hydrolysis coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates the number of sodium pumps transported to the plasma membrane through the assembly of alpha/beta heterodimers. It also plays a role in cell adhesion and establishing epithelial cell polarity.
Gene References Into Functions
  1. Research shows that Na(+)/K(+)-ATPase's DR-region specific monoclonal antibody and direct activator DRm217 increased Na(+)/K(+)-ATPase activity and reduced Ca(2+) levels. PMID: 27563007
  2. The amino acid region (198-207) is crucial for both trans-dimerization of the Na+/K+-ATPase beta1 subunits and cell-to-cell adhesion. PMID: 22328500
  3. Interactions between the beta subunits of neighboring cells maintain the integrity of intercellular junctions. PMID: 21642423
  4. Analysis of pathways for maturation of the Na,K-ATPase beta1 and beta2 subunits in the endoplasmic reticulum. PMID: 20937802
  5. Data demonstrate that Na(+),K(+)-ATPase beta 1 subunits exhibit sufficient proximity and affinity to permit a direct interaction, without requiring any additional extracellular molecules to bridge the distance. PMID: 20444976
  6. FXYD7 decreases the apparent K(+) affinity of rat alpha 1-beta 1 and alpha 2-beta 1, but not of alpha 3-beta1 isozymes. PMID: 12093728
  7. Expression of Na/K ATPase beta1 subunit mRNA was transiently increased in astrocytes after reoxygenation, whereas hypoxia itself did not induce any gene expression change. PMID: 12573531
  8. Glucocorticoids directly stimulate transcription of Na+-K+-ATPase beta1 gene expression in adult rat lung epithelial cells through a GR-dependent mechanism that can act at multiple sites. PMID: 12754184
  9. The 143-nt segment in the distal segment of the 3'-UTR of beta1 mRNA may play a significant role in the regulation of beta1-subunit expression. PMID: 14761885
  10. Beta(1)-Na(+),K(+)-ATPase is likely to represent the most physiological and efficient subunit for HKalpha(2) assembly in distal colon. PMID: 15327400
  11. The TM domain of FXYD7 has a role in mediating the complex interactions of FXYD7 with Na,K-ATPase. PMID: 16269407
  12. Following an ischemic insult, alpha1 and beta1 protein subunit abundance and mRNA levels are independently regulated. PMID: 16708288
  13. Spermidine induction of Atp1b1 in the small intestine may be mediated by altered ornithine decarboxylase expression. PMID: 17673438
  14. The ER quality control system allows export only of assembled alpha-beta complexes to the Golgi, while the number of alpha(1) subunits in the ER determines the amount of the alpha-beta complexes. PMID: 19764716

Show More

Hide All

Database Links

KEGG: rno:25650

STRING: 10116.ENSRNOP00000003932

UniGene: Rn.8925

Protein Families
X(+)/potassium ATPases subunit beta family
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.
Tissue Specificity
Expressed in the brain, liver, testes and anterior prostate (at protein level).

Q&A

What is the basic structure and function of Atp1b1 in rat models?

Rat Atp1b1 (also known as Sodium/potassium-dependent ATPase subunit beta-1) is a 305-amino acid protein that functions as the beta subunit of the Na+/K+-ATPase complex. The protein contains a small cytoplasmic domain (coded by exon 1), a transmembrane domain (partially coded by exon 2), and a large extracellular domain comprising 243 of the 305 amino acids. This extracellular domain is crucial for proper folding and trafficking of the alpha subunit to the plasma membrane. Functionally, Atp1b1 works with the catalytic alpha subunit to maintain electrochemical gradients across cell membranes by pumping sodium ions out and potassium ions into cells, which is essential for various cellular processes including neuronal excitability, cell volume regulation, and secondary active transport .

How is Atp1b1 expression distributed across different tissues and cell types?

Atp1b1 shows heterogeneous expression across different tissues and cell types. In the brain, expression varies significantly between regions and neuronal subtypes. Studies have revealed that parvalbumin (PV)-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex express particularly high levels of Atp1b1, while expressing lower levels of other beta subunit isoforms (Atp1b2 and Atp1b3). In the lungs, Atp1b1 is expressed in both alveolar epithelial type I (AT1) and type II (AT2) cells, playing a crucial role in alveolar fluid homeostasis. This regional and cell-type specific expression pattern suggests specialized functions of Atp1b1 in different physiological contexts .

What are the key differences between Atp1b1 and other beta subunit isoforms?

Atp1b1 is one of three beta subunit isoforms (Atp1b1, Atp1b2, and Atp1b3) that can associate with the alpha subunits of Na+/K+-ATPase. The isoforms differ in their tissue distribution and functional properties. While Atp1b1 is widely expressed across many tissues, it shows particularly high expression in parvalbumin-expressing neurons compared to Atp1b2 and Atp1b3. This differential expression pattern suggests that Atp1b1 may have specialized functions in certain neuronal populations. The isoforms also differ in their protein structure, post-translational modifications, and interaction partners, which contribute to their distinct physiological roles. Understanding these differences is essential when designing isoform-specific experimental approaches .

What are the optimal methods for detecting and quantifying Atp1b1 in rat tissue samples?

For detecting and quantifying Atp1b1 in rat tissue samples, researchers should consider several complementary approaches:

ELISA-based quantification: Sandwich ELISA provides high sensitivity (down to 0.057 ng/mL) and a detection range of 0.156-10 ng/mL for rat Atp1b1. This method is particularly useful for quantitative analysis in tissue homogenates and biological fluids .

Western blotting: For protein expression analysis, western blotting using specific anti-Atp1b1 antibodies can detect the protein in tissue lysates. This technique allows for semi-quantitative analysis of expression levels and can confirm specificity via molecular weight verification .

In situ hybridization: For localization studies, in situ hybridization targeting Atp1b1 mRNA provides spatial information about expression patterns across different cell types within complex tissues .

Immunohistochemistry/immunofluorescence: These techniques offer cellular and subcellular localization data, which is particularly valuable when studying heterogeneous tissues with variable Atp1b1 expression .

The choice of method depends on the specific research question, with ELISA being optimal for quantification, while imaging-based techniques provide essential spatial information about expression patterns.

How can researchers effectively generate and validate Atp1b1 knockout models?

Generating and validating Atp1b1 knockout models requires a strategic approach:

Conditional knockout strategy: Complete Atp1b1 knockout is likely lethal, so conditional approaches are recommended. Create a mouse line with a floxed allele of the Atp1b1 gene, targeting critical exons (such as exon 4) with loxP sites. This approach enables cell-specific gene knockout when combined with cell-type-specific Cre recombinase expression .

Tissue-specific targeting: For tissue-specific knockouts, use appropriate promoter-driven Cre recombinase systems. For example, Aqp5-Cre can target AT1 cells, while Sftpc-Cre can target AT2 cells in lung tissue. This allows for investigation of cell-type-specific roles of Atp1b1 .

Validation methods:

  • Genomic PCR to confirm successful recombination of the floxed allele

  • Western blotting to verify protein depletion in targeted tissues

  • Reporter systems (e.g., ROSA-mT/mG) to confirm cell-specific Cre activity

  • Functional assays to demonstrate physiological consequences of the knockout

When reporting knockout results, clearly document the specific exon(s) targeted, the deletion strategy, and comprehensive validation data to ensure reproducibility and proper interpretation of results.

What are the critical considerations for designing experiments with recombinant Atp1b1 proteins?

When designing experiments with recombinant Atp1b1 proteins, researchers should consider:

Protein source and production system: Recombinant Atp1b1 can be produced using various systems including cell-free protein synthesis (CFPS) or expression in bacterial, insect, or mammalian cells. Each system offers different advantages regarding post-translational modifications, folding, and yield. CFPS systems can provide rapid production with reduced contamination risks .

Purification tags and their effects: Common tags include Strep-tag, His-tag, or GST. Consider whether the tag might interfere with protein function or structure. For functional studies, compare tagged and untagged versions or use cleavable tags .

Protein quality control:

  • Verify purity using SDS-PAGE

  • Confirm identity via Western blotting or mass spectrometry

  • Assess functionality through activity assays specific to Na+/K+-ATPase

  • Check for proper folding using circular dichroism or thermal shift assays

Storage conditions: Optimize buffer composition, pH, and additives to maintain stability. Determine whether glycerol addition, snap freezing, or storage as lyophilized powder is optimal for your specific application .

Experimental applications: For binding studies, surface plasmon resonance or isothermal titration calorimetry can characterize interactions with alpha subunits or other partners. For structural studies, consider the impact of detergents or lipid environments on protein stability and function.

How can researchers investigate the role of Atp1b1 in neuronal function and disease models?

Investigating Atp1b1's role in neuronal function requires multifaceted approaches:

Cell-type specific analysis: Leverage the heterogeneous expression pattern of Atp1b1 across brain regions and neuronal subtypes. Focus on parvalbumin (PV)-expressing GABAergic neurons in the hippocampus, somatosensory cortex, and retrosplenial cortex, which express high levels of Atp1b1 and low levels of Atp1b2/Atp1b3 .

Electrophysiological assessments: Measure neuronal excitability, action potential generation, and ion transport in normal versus Atp1b1-deficient neurons using patch-clamp techniques. Correlate findings with Atp1b1 expression levels in specific neuronal populations .

Conditional knockout approaches: Generate neuron-specific Atp1b1 knockouts using neuron-specific promoters driving Cre recombinase expression. Compare phenotypes with global or region-specific knockouts to isolate neuronal-specific functions .

Disease model integration:

  • For hypertension models: Investigate blood pressure regulation and vascular tone in relation to neuronal Atp1b1 function

  • For heart failure models: Examine neurohormonal regulation and autonomic control

  • For neurological disorders: Assess seizure susceptibility, cognitive function, and neurodegeneration in Atp1b1-modified animals

Multi-omics approaches: Combine transcriptomics, proteomics, and metabolomics to identify adaptive responses and downstream pathways affected by Atp1b1 modulation in neuronal systems. This can reveal unexpected connections to disease mechanisms.

What are the established methods for studying Atp1b1 in lung fluid homeostasis?

To study Atp1b1's role in lung fluid homeostasis, researchers should consider:

Alveolar fluid clearance (AFC) measurements: Use in vivo intratracheal instillation of isotonic fluid containing albumin, followed by measurement of protein concentration changes over time. This directly quantifies the rate of fluid clearance, which is significantly reduced in Atp1b1-deficient models .

Mouse alveolar epithelial cell monolayers (MAECM): Isolate and culture primary AT2 cells from control and Atp1b1 knockout mice. As these cells differentiate in culture, measure transepithelial resistance (RT) and equivalent short-circuit current (IEQ) to assess barrier integrity and ion transport capacity .

Cell-specific knockout comparisons: Generate and compare AT1-specific (using Aqp5-Cre) versus combined AT1/AT2 (using Sftpc-Cre) Atp1b1 knockout models. This approach revealed that AT1-specific knockout reduces AFC by 43%, while the combined knockout shows even greater reduction, indicating the importance of Atp1b1 in both cell types .

Biochemical transport studies: Use radioisotope-labeled ions to measure Na+ and K+ transport rates across epithelial barriers. Combine with specific inhibitors of Na+/K+-ATPase (e.g., ouabain) to determine the specific contribution of Atp1b1-containing pumps.

This methodological framework allows for comprehensive assessment of Atp1b1's role in pulmonary fluid balance at both cellular and tissue levels.

How do post-translational modifications affect Atp1b1 function in different physiological contexts?

Post-translational modifications (PTMs) of Atp1b1 significantly impact its function:

Glycosylation patterns: Atp1b1 contains multiple N-glycosylation sites in its extracellular domain that affect protein stability, trafficking, and function. Different glycosylation patterns can be tissue-specific and alter the protein's half-life and interaction capabilities. Researchers should use glycosidase treatments and glycosylation site mutants to investigate these effects .

Phosphorylation events: Phosphorylation of specific residues can modulate Atp1b1's interaction with the alpha subunit and other partners. Analysis methods include:

  • Phosphoproteomic mass spectrometry to identify modification sites

  • Phospho-specific antibodies for detection

  • Phosphomimetic and phospho-resistant mutants to study functional consequences

Oxidative modifications: Under oxidative stress, cysteine residues in Atp1b1 may form disulfide bonds or become otherwise modified, affecting protein function. Redox proteomic approaches can identify these modifications in different physiological and pathological states.

Methodology for studying PTMs:

  • Tissue-specific PTM profiling using mass spectrometry

  • Site-directed mutagenesis to create modification-resistant forms

  • Comparison of PTM patterns between normal and disease states

  • Correlation of PTM changes with functional outcomes using activity assays

Understanding these modifications is crucial as they may explain tissue-specific functions and provide potential therapeutic targets in diseases associated with Atp1b1 dysfunction.

How can researchers address inconsistent results when measuring Atp1b1 levels in different experimental systems?

Inconsistent results when measuring Atp1b1 levels can stem from multiple factors:

Standardization of sample preparation:

  • For tissue homogenates: Implement standardized homogenization protocols with consistent buffer composition, protease inhibitors, and sample-to-buffer ratios

  • For cell cultures: Harvest cells at consistent confluence and passage numbers

  • For all samples: Minimize freeze-thaw cycles and standardize protein extraction methods

Assay-specific considerations:

  • For ELISA: Verify antibody specificity, optimize dilution ranges (0.156-10ng/mL for rat Atp1b1), and include standard curves on each plate to account for inter-assay variation

  • For Western blotting: Use validated antibodies, include loading controls, and perform quantification relative to housekeeping proteins with similar stability characteristics

  • For qPCR: Design primers specific to Atp1b1 that don't amplify other beta subunit isoforms, and validate using melt curve analysis

Data normalization strategies:

  • Express results relative to multiple reference genes or proteins

  • Consider using absolute quantification with recombinant standards when possible

  • Account for cellular heterogeneity in complex tissues using cell-type-specific markers

Cross-validation approach:

  • Employ at least two independent detection methods (e.g., ELISA and Western blot)

  • Compare mRNA and protein levels to identify post-transcriptional regulation

  • Validate key findings using independent biological replicates and different experimental models

By systematically addressing these factors, researchers can significantly improve consistency and reliability when measuring Atp1b1 levels across different experimental systems.

What are the common pitfalls when interpreting results from Atp1b1 knockout studies?

When interpreting results from Atp1b1 knockout studies, researchers should be aware of these potential pitfalls:

Compensatory mechanisms:

Developmental versus acute effects:

  • Constitutive knockouts may trigger developmental adaptations distinct from acute loss in adult tissues

  • Inducible knockout systems should be considered to distinguish between these scenarios

Cell type specificity considerations:

  • Heterogeneous expression of Atp1b1 across cell types means that whole-tissue knockouts may have complex phenotypes reflecting multiple cellular responses

  • Cell-type-specific knockouts (e.g., AT1-specific versus combined AT1/AT2) provide more precise information but require careful validation of targeting specificity

Knockout efficiency variations:

  • Incomplete recombination can lead to residual Atp1b1 expression

  • Thorough validation using genomic PCR, protein expression analysis, and functional assays is essential

  • Quantify knockout efficiency when possible and correlate with phenotypic severity

Strain-dependent effects:

  • Genetic background can significantly influence knockout phenotypes

  • Use appropriate controls from the same genetic background, ideally littermates

  • Consider backcrossing to establish pure genetic backgrounds

How should researchers approach contradictory data between in vitro and in vivo Atp1b1 studies?

When facing contradictions between in vitro and in vivo Atp1b1 studies, researchers should:

Identify specific discrepancies:

  • Categorize contradictions as functional (e.g., transport activity differences), expressional (e.g., regulation patterns), or phenotypic (e.g., physiological outcomes)

  • Determine whether contradictions are qualitative or quantitative in nature

Evaluate model-specific limitations:

  • In vitro systems: Consider artificial expression levels, lack of physiological regulation, absence of tissue architecture, and limited cell-cell interactions

  • In vivo systems: Account for compensatory mechanisms, systemic effects, strain differences, and developmental adaptations

Bridging strategies:

  • Use ex vivo systems (e.g., freshly isolated AT2 cells cultured as monolayers) as intermediates between in vitro and in vivo models

  • Develop organoid models that better recapitulate tissue architecture while allowing controlled manipulation

  • Employ tissue-specific conditional knockouts to isolate effects within specific cellular contexts

Reconciliation approaches:

  • Perform dose-response and time-course studies to identify transient versus sustained effects

  • Apply systems biology approaches to model complex interactions absent in simplified systems

  • Use genetic rescue experiments to confirm specific protein functions

  • Develop computational models that integrate in vitro kinetic parameters with in vivo physiological constraints

Data integration framework:

ParameterIn Vitro SystemIn Vivo SystemPotential Reconciliation Approach
Protein activityDirect measurement in simplified systemsInferred from physiological outcomesUse of ex vivo preparations with activity assays
Expression patternsOften artificially controlledSubject to complex regulationSingle-cell analysis of in vivo samples
Interaction partnersLimited to defined componentsComplete physiological contextProximity labeling approaches in vivo
Temporal dynamicsUsually short-termIncludes long-term adaptationsInducible systems with time-course analysis

By systematically analyzing contradictions using this framework, researchers can develop more accurate and comprehensive models of Atp1b1 function.

What emerging technologies are transforming Atp1b1 research?

Several cutting-edge technologies are significantly advancing Atp1b1 research:

CRISPR/Cas9 genome editing:

  • Enables precise modification of Atp1b1 at the genomic level

  • Allows introduction of specific mutations corresponding to human disease variants

  • Facilitates rapid generation of cell and animal models with targeted modifications

Single-cell transcriptomics/proteomics:

  • Reveals cell-type-specific expression patterns of Atp1b1 and associated proteins

  • Identifies previously unknown cellular populations with distinctive Atp1b1 expression profiles

  • Enables correlation of Atp1b1 expression with broader transcriptional programs in specific cell types

Advanced imaging techniques:

  • Super-resolution microscopy reveals subcellular localization and co-localization with interaction partners

  • Live-cell imaging with fluorescent protein tags monitors dynamics of Atp1b1 trafficking and membrane insertion

  • Multiplexed ion beam imaging (MIBI) or Imaging Mass Cytometry (IMC) allows simultaneous visualization of multiple proteins in tissue context

Structural biology advances:

  • Cryo-electron microscopy provides high-resolution structures of Na+/K+-ATPase complexes

  • Molecular dynamics simulations predict functional effects of specific mutations or modifications

  • Hydrogen-deuterium exchange mass spectrometry maps protein dynamics and interaction surfaces

Physiological monitoring platforms:

  • Multiparameter physiological recording in knockout models captures complex phenotypes

  • Organ-on-a-chip technologies model Atp1b1 function in tissue-specific contexts

  • Automated high-content screening identifies novel modulators of Atp1b1 activity

These technologies collectively enable more precise, comprehensive, and physiologically relevant investigations of Atp1b1 function in health and disease.

What are the unexplored aspects of Atp1b1 regulation that warrant further investigation?

Several aspects of Atp1b1 regulation remain understudied and represent promising research directions:

Non-coding RNA regulation:

  • The role of microRNAs in post-transcriptional regulation of Atp1b1 expression

  • Long non-coding RNAs that may act as competing endogenous RNAs affecting Atp1b1 mRNA stability

  • Potential RNA-binding proteins that regulate Atp1b1 mRNA translation efficiency

Epigenetic control mechanisms:

  • DNA methylation patterns in the Atp1b1 promoter across different tissues and disease states

  • Histone modifications that regulate tissue-specific expression

  • Chromatin accessibility dynamics during development and in response to physiological stressors

Protein-protein interaction networks:

  • Beyond the canonical alpha subunit interaction, identifying novel protein partners that modulate Atp1b1 function

  • Characterizing the Atp1b1 interactome in different cellular compartments and physiological states

  • Understanding how these interactions are dynamically regulated

Subcellular trafficking mechanisms:

  • The molecular machinery controlling Atp1b1 movement from the endoplasmic reticulum to the plasma membrane

  • Endocytic recycling pathways that regulate surface expression levels

  • Compartment-specific functions of Atp1b1 in intracellular organelles

Metabolic regulation:

  • How cellular energetics and metabolic state influence Atp1b1 expression and function

  • Potential roles for Atp1b1 in metabolic sensing or adaptation

  • Integration of Atp1b1 function with broader cellular metabolic networks

Investigating these regulatory mechanisms would significantly advance our understanding of how Atp1b1 function is fine-tuned in different physiological contexts and may reveal new therapeutic targets for diseases associated with Na+/K+-ATPase dysfunction.

How might Atp1b1 research inform therapeutic strategies for related diseases?

Atp1b1 research has significant potential to inform novel therapeutic approaches:

Hypertension and cardiovascular disease:

  • Understanding the role of neuronal Atp1b1 in blood pressure regulation could lead to more targeted antihypertensive therapies

  • Identification of specific Atp1b1 variants associated with salt sensitivity may enable personalized treatment approaches

  • Development of compounds that modulate specific alpha-beta subunit combinations could provide tissue-selective effects

Pulmonary edema and acute lung injury:

  • Atp1b1's critical role in alveolar fluid clearance suggests potential therapeutic targets for enhancing fluid resolution in pulmonary edema

  • Cell-specific targeting strategies (AT1 versus AT2 cells) based on knockout studies may allow more precise interventions

  • Compounds that enhance Atp1b1 expression or function could accelerate recovery from acute lung injury

Neurological disorders:

  • The high expression of Atp1b1 in parvalbumin-positive neurons suggests potential relevance to disorders involving this neuronal population (including certain forms of epilepsy and schizophrenia)

  • Region-specific modulation of Atp1b1 function might provide new approaches for treating localized neurological conditions

  • Understanding how Atp1b1 contributes to neuronal excitability could lead to novel neuromodulatory strategies

Therapeutic modalities:

  • Small molecule modulators targeting specific Atp1b1-containing Na+/K+-ATPase complexes

  • Gene therapy approaches for genetic disorders involving Atp1b1 mutations

  • RNA-based therapeutics to modulate Atp1b1 expression in specific tissues

  • Peptide-based approaches targeting specific protein-protein interactions

Translational potential exists in multiple therapeutic areas, with the cell-type-specific nature of Atp1b1 expression offering opportunities for targeted interventions with potentially reduced side effects compared to traditional Na+/K+-ATPase modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.