Recombinant Rat Solute carrier family 22 member 3 (Slc22a3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributor.
Please note: All protein shipments default to standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquotting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Slc22a3; Oct3; Solute carrier family 22 member 3; Organic cation transporter 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-551
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc22a3
Target Protein Sequence
MPTFDQALRKAGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGSQPDYYWCRGPRATALA ERCAWSPEEEWNLTTPELHVPAERRGQGHCHRYLLEDTNTSSELSCDPLAAFPNRSAPLV PCSGDWRYVETHSTIVSQFDLVCGNAWMLDLTQAILNLGFLAGAFTLGYAADRYGRLIVY LISCFGVGITGVVVAFAPNFSVFVIFRFLQGVFGKGAWMTCFVIVTEIVGSKQRRIVGIV IQMFFTLGIIILPGIAYFTPSWQGIQLAISLPSFLFLLYYWVVPESPRWLITRKQGEKAL QILRRVAKCNGKHLSSNYSEITVTDEEVSNPSCLDLVRTPQMRKCTLILMFAWFTSAVVY QGLVMRLGLIGGNLYMDFFISGLVELPGALLILLTIERLGRRLPFAASNIVAGVSCLVTA FLPEGIPWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFGGIIAP FLLFRLAAIWLELPLIIFGILASVCGGLVMLLPETKGIALPETVEDVEKLGSSQLHQCGR KKKTQVSTSNV
Uniprot No.

Target Background

Function
This protein facilitates potential-dependent transport of a variety of organic cations. It may play a significant role in the clearance of cationic neurotoxins and neurotransmitters within the brain.
Gene References Into Functions
  1. This study is the first to examine the subcellular localization of organic cation transporter 3 (OCT3) in any tissue and the first to explore its spatial relationship with synaptic structures in the brain. The findings suggest that OCT3 not only contributes to the clearance of extracellular monoamines but also plays a role in their intracellular disposition and action. PMID: 27659446
Database Links
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Highly expressed in placenta. Moderate expression in intestine, heart and brain. In the brain, widely expressed, especially in hippocampus, cerebellum and cerebral cortex. Expression is low in kidney and lung and undetectable in liver.

Q&A

What is Slc22a3 and what is its primary function in experimental models?

Slc22a3 encodes organic cation transporter 3 (OCT3), a membrane protein responsible for transporting various endogenous and exogenous organic cations across cellular membranes. This includes neurotransmitters (norepinephrine, dopamine, histamine) and certain pharmaceutical compounds. In experimental models, Slc22a3/OCT3 serves critical roles in neurotransmitter clearance, detoxification processes in peripheral tissues, and salt-intake regulation.

Previous research has established that OCT3/Slc22a3 participates in general detoxification functions and is implicated in salt-intake regulation mechanisms . Its expression pattern differs significantly from related transporters Slc22a1 (OCT1) and Slc22a2 (OCT2), with studies showing almost no expression of these related genes in certain tissues where Slc22a3 is abundant .

Which tissues in rats express the highest levels of Slc22a3?

Slc22a3 demonstrates tissue-specific distribution patterns in rats with significant implications for research design and interpretation:

TissueRelative Expression LevelFunctional Significance
PlacentaVery highFetal protection barrier
KidneyHighOrganic cation secretion
LiverHighDrug metabolism and detoxification
Small intestineModerate to highNutrient/drug absorption
LungModerateAirway physiology regulation
BrainVariable by regionNeurotransmitter regulation
HeartLow to moderateCardiac drug disposition

In the brain, expression is region-specific with notable presence in the hypothalamus, which aligns with its role in salt regulation . Researchers should verify expression levels in their specific rat strain and experimental conditions as variation exists between models.

How can recombinant rat Slc22a3 protein be effectively expressed and purified?

The production of functional recombinant rat Slc22a3 requires careful optimization of expression systems and purification protocols:

Expression Systems Options:

  • Mammalian cell systems (HEK293, CHO) offer proper post-translational modifications

  • Baculovirus-insect cell systems provide higher yields while maintaining reasonable activity

  • Bacterial systems require specific solubilization strategies but can generate larger quantities

Optimized Purification Protocol:

  • Transfect expression vector containing rat Slc22a3 cDNA into chosen expression system

  • Culture cells under optimized conditions (temperature, media components)

  • Harvest cells and isolate membrane fraction through differential centrifugation

  • Solubilize membrane proteins using appropriate detergents (n-Dodecyl β-D-maltoside or CHAPS)

  • Perform affinity chromatography using engineered tags (His-tag, FLAG-tag)

  • Conduct size exclusion chromatography for further purification

  • Validate protein activity through transport assays with known substrates

Maintaining the native conformation during purification is critical for functional studies, often requiring careful optimization of detergent conditions and buffer systems .

What are the key substrates transported by rat Slc22a3?

Rat Slc22a3 (OCT3) transports various organic cations with different affinities. Understanding substrate specificity is essential for experimental design:

Endogenous Substrates:

  • Monoamine neurotransmitters: Dopamine, norepinephrine, serotonin

  • Histamine

  • Agmatine

  • Choline

  • Creatinine

Exogenous Substrates:

  • Model cations: 1-methyl-4-phenylpyridinium (MPP+), tetraethylammonium (TEA)

  • Pharmaceuticals: Metformin, cimetidine, corticosterone

  • Environmental toxins: Paraquat, ethidium

Research indicates OCT3 can transport norepinephrine, dopamine, histamine, and certain drugs across plasma membranes, making it particularly important in neurological and pharmacological research .

How can Slc22a3 knockout rat models be generated and validated?

Generation Approaches:

  • CRISPR/Cas9 System:

    • Design sgRNAs targeting exonic regions of Slc22a3

    • Introduce frameshift mutations or large deletions

    • Screen founder animals using genomic PCR and sequencing

  • Homologous Recombination:

    • Design targeting vectors with homology arms

    • Replace critical exons with selection markers

    • Select for successful integration events

Comprehensive Validation Protocol:

  • Genotypic Validation:

    • PCR-based genotyping with primers flanking the targeted region

    • Sequencing of the modified locus to confirm intended mutation

    • Copy number analysis to exclude unintended duplications

  • Expression Analysis:

    • RT-PCR verification of wild-type transcript absence

    • RNA-Seq assessment of potential alternative splicing

    • Northern blotting for complete transcript loss confirmation

  • Protein Validation:

    • Western blotting using specific antibodies

    • Immunohistochemistry in tissues normally expressing Slc22a3

    • Functional transport assays with known substrates

  • Phenotypic Characterization:

    • Assessment of salt preference behavior (based on previous findings )

    • Evaluation of neurological parameters

    • Analysis of drug pharmacokinetics

Previous research with OCT3/Slc22a3-deficient mice generated through homologous recombination demonstrated altered salt-intake behaviors, providing a foundation for phenotypic validation .

How does the methylation status of Slc22a3 affect its expression in disease models?

DNA methylation represents a key regulatory mechanism for Slc22a3 expression with significant implications for disease modeling. Based on human studies, specific methylation patterns correlate with expression levels:

Methylation Analysis Approaches:

  • Bisulfite sequencing for single-nucleotide resolution methylation profiles

  • Methylation-specific PCR for targeted analysis of known methylation sites

  • Methylation arrays adapted for rat genome (comparative approach)

  • Pyrosequencing for quantitative analysis of specific CpG sites

Key Methylation Patterns:

  • Hypomethylation of the Slc22a3 promoter correlates with increased expression

  • Hypermethylation of the Slc22a3 gene body may also correlate with increased expression

  • Different disease states show distinct methylation signatures

Human studies have demonstrated that differential expressions of SLC22A3 correlate with DNA methylation patterns, with hypomethylation of the gene promoter and hypermethylation of the gene body observed in high-expression tumors . This suggests similar epigenetic regulation may occur in rat Slc22a3.

RegionEffect of MethylationAnalysis MethodResearch Application
Promoter CpG islandsDecreased expressionBisulfite sequencingCancer models, stress studies
Gene bodyIncreased expressionMethylation arraysInflammatory disease models
Enhancer regionsVariable effectsATAC-Seq with methylation analysisDevelopmental studies

What role does Slc22a3 play in inflammatory pathways and immune response?

Emerging research suggests significant connections between Slc22a3 and inflammatory processes, offering valuable research opportunities:

Experimental Approaches for Inflammation Studies:

  • In Vivo Inflammation Models:

    • LPS-induced systemic inflammation

    • Disease-specific models (arthritis, inflammatory bowel disease)

    • Comparison of wild-type versus Slc22a3-deficient animals

  • Analytical Methods:

    • Flow cytometry for immune cell population analysis

    • RNA-Seq for transcriptional responses in inflammation

    • Multiplex cytokine profiling in various tissues

    • Immunohistochemistry for inflammatory markers co-stained with Slc22a3

  • Mechanistic Investigations:

    • Transport assays for inflammatory mediators

    • Pharmacological intervention studies

    • Cell-specific Slc22a3 manipulation

Human studies have shown that SLC22A3 expression positively correlates with immune-related pathways including inflammatory response and abundance of infiltrating immune cells in the tumor microenvironment . High SLC22A3 expression has been associated with upregulation of immunological checkpoint inhibitory molecules, suggesting complex immune regulatory functions .

How can researchers effectively analyze Slc22a3 expression in experimental models?

Accurate quantification and characterization of Slc22a3 expression requires robust methodological approaches:

Expression Analysis Methods:

  • Transcriptional Analysis:

    • qRT-PCR for relative expression quantification

    • RNA-Seq for comprehensive transcriptome analysis

    • In situ hybridization for spatial localization

    • Single-cell RNA-Seq for cell-type specific expression

  • Protein Analysis:

    • Western blotting for tissue-specific expression levels

    • Immunohistochemistry/immunofluorescence for cellular localization

    • Flow cytometry for single-cell protein expression

    • ELISA for quantitative measurement in tissue homogenates

  • Functional Assessment:

    • Uptake assays with fluorescent or radiolabeled substrates

    • Electrophysiological recordings

    • Membrane vesicle transport studies

Critical Considerations:

  • Expression levels may vary significantly between rat strains

  • Age, sex, and environmental factors influence expression patterns

  • Disease states can dramatically alter expression profiles

Research indicates that in the TCGA-LUSC dataset, the mean, median, and standard deviation of SLC22A3 expression were 3.3, 1.4, and 6.2 FPKM, respectively, demonstrating considerable expression variation . Similar variation likely exists in rat models.

What is the significance of Slc22a3 in neurological research using rat models?

Slc22a3's role in neurotransmitter transport makes it particularly relevant for neurological research:

Neurological Research Applications:

  • Neurotransmitter Clearance Studies:

    • Monoamine uptake and clearance in specific brain regions

    • Impact on synaptic neurotransmitter concentrations

    • Influence on signaling duration and strength

  • Behavioral Paradigms:

    • Stress response modeling

    • Anxiety and depression assessments

    • Salt preference and intake behaviors

    • Addiction and reward processing

  • Neuropharmacological Applications:

    • Drug disposition in the CNS

    • Blood-brain barrier transport mechanisms

    • Psychotropic medication efficacy studies

  • Advanced Techniques:

    • In vivo microdialysis with Slc22a3 modulation

    • Optogenetic studies combined with transporter manipulation

    • Circuit-specific analysis of Slc22a3 function

OCT3/Slc22a3-deficient mice showed altered responses in salt-intake conditions, suggesting important roles in osmotic regulation and related behaviors . Additionally, neuroimmunohistochemical studies have demonstrated Slc22a3 localization in specific brain regions implicated in stress response and homeostatic regulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.