Recombinant Rat Solute carrier family 25 member 34 (Slc25a34)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Expression system:

  • Expressed in E. coli using codon-optimized vectors .

Purification:

  • Affinity chromatography via His-tag .

Functional validation:

  • Activity assays (not explicitly detailed in sources) likely involve substrate transport studies using reconstituted liposomes, a standard method for mitochondrial carriers .

Key functional hypotheses:

  • May participate in mitochondrial DNA/RNA synthesis by importing pyrimidine nucleotides .

  • Could regulate zinc ion transport, as observed in related carriers .

Research Applications

Common uses:

  • Antibody development: Anti-Slc25a34 polyclonal antibodies are validated for ELISA and Western blot .

  • Gene overexpression: Adenoviral vectors (e.g., Cat. No. 44018056) enable transient Slc25a34 expression in mammalian cells .

  • Structural studies: Full-length recombinant protein supports crystallography or cryo-EM analyses .

Related products:

Product NameHost SystemPurityVendor
Recombinant Rat Slc25a34 (Partial)Mammalian cells≥85%MyBioSource
SLC25A34 Adenovirus (Rat)HEK293 cells>1×10⁶ PFU/mLabm

Limitations and Future Directions

  • Functional ambiguity: Substrate specificity and kinetic parameters require further validation .

  • Therapeutic potential: No direct links to diseases reported, unlike SLC25A38 (linked to sideroblastic anemia) .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us, and we will prioritize development with the specified tag.
Synonyms
Slc25a34; Solute carrier family 25 member 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a34
Target Protein Sequence
MTLTQAQMAPATDSREMVSPAVDLVLGASACCLACVFTNPLEVVKTRLQLQGELQAPGTY PRPYRGFVSSVTAVARADGLWGLQKGLAAGLLYQGLMNGVRFYCYSLACQAGLTQQPGGT VVAGAVAGALGAFVGSPAYLVKTQLQAQTGAAVAVGHQHQHQGVLSALETIWRQQGMLGL WRGVGAAVPRVTVGSAAQLATFTSAKAWVQDQQWFLEDSWLATLAGGMISSIAVVAVMAP FDVVSTRLYNQPVDRAGRGQLYGGLTDCLVKTCQQEGPLALYKGVGPAYLRLGPHTILSM FFWDELRKLALRAQHPGT
Uniprot No.

Target Background

Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a34 and how does it function in cellular metabolism?

Slc25a34 belongs to the SLC25 family that consists of 53 inner mitochondrial membrane proteins shown and/or predicted to function as solute carriers involved in the transport of biomolecules (e.g., amino acids, nucleotides, carboxylates, keto acids, other substrates) across the inner mitochondrial membrane . Current research demonstrates that Slc25a34 plays a significant role in mitochondrial respiration and bioenergetics, particularly in relation to nonalcoholic fatty liver disease (NAFLD) .

Methodologically, understanding Slc25a34 function requires examining its impact on cellular energy homeostasis. Experimental manipulation of Slc25a34 expression reveals that hepatocytes depleted of Slc25a34 display increased mitochondrial biogenesis, lipid synthesis, and ADP/ATP ratio, whereas Slc25a34 overexpression produces opposite effects . This bidirectional relationship suggests Slc25a34 serves as a critical regulator of mitochondrial energy metabolism.

What experimental models are available for studying Slc25a34 function?

Several experimental models have been established to investigate Slc25a34 function:

In vitro models:

  • Primary hepatocyte cultures with Slc25a34 depletion or overexpression

  • Recombinant protein expression systems including E. coli, yeast, baculovirus, mammalian cells, and cell-free expression platforms

In vivo models:

  • Hepatocyte-specific Slc25a34 knockout mice (Slc-HKO) generated via AAV8-TBG-Cre virus injection

  • Slc25a34 floxed mice as controls (injected with AAV8-TBG-GFP)

  • Diet-based experimental models (standard chow vs. fast-food diet) to examine Slc25a34 function in metabolic disease contexts

When selecting an experimental model, researchers should consider the specific aspects of Slc25a34 biology they aim to investigate. For metabolism studies, the hepatocyte-specific knockout model combined with dietary manipulation has proven particularly informative .

How is Slc25a34 gene knockout achieved in laboratory settings?

Generation of Slc25a34 knockout models involves sophisticated genetic engineering approaches:

CRISPR/Cas9-mediated targeting strategy:

  • The Slc25a34 gene contains 5 exons with intron/exon junctions in the same reading frame, preventing simple exon deletion strategies

  • Instead, the targeting strategy involves flanking exon 1 and the promoter region with LoxP sites

  • The conditional knockout allele is generated directly in mouse zygotes using CRISPR/Cas9 technology following the Easi-CRISPR strategy

Technical procedure:

  • Long single-stranded DNA serves as a template and is injected with pre-assembled Cas9 ribonucleoprotein complexes

  • The target sequence single guide RNAs are 5′-GAGAGAATAGGGCTATAATCTGG-3′ (Slc25a34-guide3) and 5′-AAACTGACACGCCCAACCCAGGG-3′ (Slc25a34-guide6)

  • Mice carrying the correctly targeted allele are identified using PCR and verified by Sanger sequencing

  • Founder mice are backcrossed to C57BL/6J for at least five generations and bred to homozygosity

Hepatocyte-specific knockout:

  • 2-month-old Slc25a34 floxed mice are injected intraperitoneally with 1.25 × 10^11 viral particles of AAV8-TBG-Cre virus, targeting >95% of hepatocytes

  • Control mice receive AAV8-TBG-GFP injection

How does Slc25a34 influence mitochondrial bioenergetics and metabolism?

Slc25a34 serves as a crucial regulator of mitochondrial function with significant impacts on cellular bioenergetics:

Effects on mitochondrial function:

  • Depletion of Slc25a34 results in increased mitochondrial biogenesis, suggesting it may normally act as a negative regulator of this process

  • Slc25a34 depletion increases the ADP/ATP ratio, indicating altered energy homeostasis

  • Overexpression produces opposite effects, suggesting dose-dependent regulation of mitochondrial energetics

Metabolic consequences:

  • RNA-sequencing of Slc25a34 knockout liver tissue reveals widespread changes in metabolic processes, particularly fatty acid metabolism

  • Loss of Slc25a34 leads to altered glucose metabolism as the most pronounced defect

  • On a fast-food diet, Slc25a34 knockout mice develop a more severe metabolic phenotype including hepatic steatosis and impaired glucose tolerance

To study these effects, researchers should employ comprehensive mitochondrial function assays including oxygen consumption measurements, mitochondrial membrane potential assessments, and detailed metabolomic profiling to capture the broad metabolic impact of Slc25a34 manipulation.

What is the role of Slc25a34 in NAFLD pathogenesis?

Slc25a34 appears to be critically involved in NAFLD development and progression:

Relationship to NAFLD mechanisms:

  • Slc25a34 is a major repressive target of miR-122, a microRNA with a central role in NAFLD and liver cancer

  • Knockout mice on fast-food diet (FFD) develop more severe NAFLD features compared to controls

Temporal dynamics of Slc25a34 in NAFLD:

  • After 2 months on FFD, Slc25a34 knockout mice exhibit a more severe phenotype with increased lipid content and impaired glucose tolerance

  • Interestingly, this phenotype attenuates after longer FFD feeding (6 months), suggesting activation of compensatory mechanisms

Phenotypic characteristics in NAFLD models:

PhenotypeNormal Diet2-Month FFD6-Month FFD
Glucose toleranceMildly abnormalSeverely impairedPartially recovered
Hepatic lipid contentNormalIncreasedModerately increased
Body weightNormalIncreasedIncreased
Liver weightNormalIncreasedIncreased
Insulin sensitivityNormalDecreasedPartially recovered
Cholesterol levelDecreasedDecreasedDecreased
Triglyceride levelDecreasedDecreasedDecreased

This data indicates that Slc25a34 plays a complex role in NAFLD pathogenesis with time-dependent effects .

What are the optimal protocols for recombinant Slc25a34 expression and purification?

For functional studies requiring recombinant Slc25a34 protein, researchers should consider:

Expression systems:

  • Cell-free expression systems provide high purity (≥85% as determined by SDS-PAGE) and are available for rat, mouse, human, and bovine Slc25a34

  • E. coli, yeast, baculovirus, and mammalian cell systems offer alternatives depending on experimental requirements

  • Selection should be based on required post-translational modifications and experimental application

Purification considerations:

  • Target purity should be ≥85% as determined by SDS-PAGE for most functional applications

  • For rat Slc25a34 specifically, cell-free expression systems have been successfully employed

  • Purification should include appropriate controls to verify protein identity and activity

Functional validation:

  • Transport assays with candidate substrates

  • ATPase activity measurements

  • Incorporation into proteoliposomes for membrane transport studies

When working with recombinant Slc25a34, researchers should carefully document the expression system used, purification methods, and verification steps to ensure reproducibility across experiments.

How does Slc25a34 interact with other mitochondrial carriers in regulating cellular metabolism?

As a member of the SLC25 family, Slc25a34 likely functions within a broader network of mitochondrial carriers:

SLC25 family context:

  • The SLC25 family consists of 53 inner mitochondrial membrane proteins with diverse substrate specificities and functions

  • These carriers collectively regulate the flux of metabolites between mitochondria and cytosol

Potential interactions:

  • Functional redundancy may exist between Slc25a34 and other family members

  • The attenuation of phenotypes after prolonged FFD exposure suggests compensatory mechanisms involving other transporters

  • Network analysis of SLC25 members reveals their importance in cancer and metabolic diseases

Research approaches to study these interactions include:

  • Co-immunoprecipitation to identify physical interactions

  • Simultaneous knockdown/knockout of multiple transporters to identify functional redundancy

  • Systems biology approaches integrating transcriptomic, proteomic, and metabolomic data

What phenotypes are observed in Slc25a34 knockout models and how do they inform function?

Slc25a34 knockout models display several distinctive phenotypes that provide insights into its physiological function:

Phenotypes in Slc25a34 knockout mice:

PhenotypeDescriptionMethodological Implications
Abnormal glucose toleranceAltered glucose handling after challengePerform glucose tolerance tests when characterizing new models
Decreased circulating glucoseLower blood glucose levelsMonitor both fasting and fed glucose levels
Hepatic steatosisIncreased liver fat accumulationEmploy histological and biochemical lipid assessments
Insulin resistanceDecreased insulin sensitivityConduct insulin tolerance tests
Increased body weightHigher body mass compared to controlsTrack weight throughout experimental timeline
Increased liver weightEnlarged liverMeasure liver-to-body weight ratio
Decreased cholesterol/triglyceridesReduced lipid levels despite steatosisPerform comprehensive lipid profiling

The complex phenotype suggests Slc25a34 regulates multiple aspects of energy metabolism . Investigators should perform comprehensive metabolic phenotyping when studying new Slc25a34 models.

What techniques are most effective for studying Slc25a34 transport activity?

To investigate the transport function of Slc25a34, researchers should consider several complementary approaches:

Reconstitution in proteoliposomes:

  • Express and purify recombinant Slc25a34 using appropriate systems (cell-free expression yields ≥85% purity)

  • Reconstitute purified protein into liposomes with composition resembling the inner mitochondrial membrane

  • Perform transport assays with radiolabeled or fluorescently tagged substrate candidates

Mitochondrial isolation and transport studies:

  • Isolate intact mitochondria from control and Slc25a34-manipulated cells/tissues

  • Measure substrate transport across the inner mitochondrial membrane

  • Compare transport kinetics between wild-type and knockout/knockdown models

Metabolic flux analysis:

  • Use stable isotope-labeled metabolites to track flux through mitochondrial pathways

  • Compare flux patterns in the presence and absence of Slc25a34

  • Identify metabolic bottlenecks induced by Slc25a34 deficiency

These approaches should be combined with bioenergetic analyses (e.g., oxygen consumption measurements) to comprehensively characterize Slc25a34 transport function.

How can contradictory findings about Slc25a34 be reconciled across different experimental models?

Researchers may encounter apparently conflicting results when studying Slc25a34. These can be addressed through:

Systematic consideration of experimental variables:

  • Temporal dynamics: Phenotypes in knockout mice change over time (e.g., more severe at 2 months FFD vs. partial recovery at 6 months FFD)

  • Dietary conditions: Standard chow vs. FFD produces markedly different phenotypes

  • Complete vs. partial knockout: Residual expression may preserve some function

  • Cell/tissue type: Hepatocyte-specific vs. whole-body effects may differ

Standardization recommendations:

  • Clearly document genetic background of models

  • Specify age, sex, and dietary conditions

  • Quantify knockout efficiency

  • Control for compensatory mechanisms

  • Perform time-course studies

Integrative approaches:

  • Meta-analysis of multiple studies

  • Systems biology perspective considering network effects

  • Multi-omics integration (transcriptomics, proteomics, metabolomics)

What is the relationship between Slc25a34 and disease states beyond NAFLD?

While NAFLD is the most studied condition in relation to Slc25a34, evidence suggests broader implications:

Cancer biology:

Metabolic disorders:

  • The phenotypes observed in Slc25a34 knockout mice (abnormal glucose tolerance, altered lipid metabolism) suggest potential roles in metabolic syndrome and diabetes

  • SLC25 genetic variants correlate with human metabolic diseases

Research methodologies to investigate these connections include:

  • Analysis of Slc25a34 expression in disease tissue samples

  • Correlation of expression with clinical outcomes

  • Functional studies in disease-specific models

  • GWAS and other genetic association studies

What are the critical unanswered questions regarding Slc25a34 function?

Despite progress in understanding Slc25a34, several fundamental questions remain:

Transport substrate identity:

  • The specific metabolites transported by Slc25a34 remain unidentified

  • Systematic substrate screening using recombinant protein is needed

  • Metabolomic profiling of knockout models may provide indirect evidence

Regulatory mechanisms:

  • How Slc25a34 expression and activity are regulated remains poorly characterized

  • Potential regulation by post-translational modifications warrants investigation

  • Transcriptional control mechanisms, including the confirmed miR-122 regulation , need further exploration

Therapeutic potential:

  • Whether Slc25a34 modulation could serve as a therapeutic strategy for NAFLD or other conditions

  • The feasibility of targeting Slc25a34 with small molecules or biologics

  • Potential side effects of Slc25a34 manipulation in different tissues

What novel technologies could advance Slc25a34 research?

Emerging technologies that could significantly impact Slc25a34 research include:

CRISPR-based approaches:

  • Base editing for introducing specific mutations without double-strand breaks

  • CRISPRi/CRISPRa for reversible modulation of expression

  • Prime editing for precise genetic modifications

Advanced imaging techniques:

  • Live-cell imaging of mitochondrial transport using fluorescent substrates

  • Super-resolution microscopy to visualize Slc25a34 localization and dynamics

  • Correlative light and electron microscopy for structural-functional insights

Single-cell technologies:

  • Single-cell transcriptomics to identify cell-specific roles of Slc25a34

  • Spatial transcriptomics to map expression patterns in complex tissues

  • Single-cell metabolomics to detect cell-to-cell variation in metabolic responses

Computational approaches:

  • Machine learning for predicting Slc25a34 substrates and interactions

  • Molecular dynamics simulations of transport mechanisms

  • Network analysis to position Slc25a34 within broader metabolic pathways

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.