Recombinant Rat Solute carrier family 25 member 42 (Slc25a42)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Rat Slc25a42 is produced using multiple expression systems:

Host SystemYieldPurityForm
E. coli~55 mg/L>90%Lyophilized powder
Mammalian Cells (HEK293)Moderate>85%Soluble protein
BaculovirusVariable>85%Lyophilized

Key Steps:

  • Expression: Induced in E. coli C0214(DE3) with codon optimization for high yield .

  • Purification: Affinity chromatography (His tag), followed by detergent removal and reconstitution into liposomes for functional assays .

  • Storage: Stable at -80°C in Tris/PBS buffer with 6% trehalose .

Biochemical Properties

Recombinant Rat Slc25a42 demonstrates strict substrate specificity and transport kinetics:

Substrate Affinity (Km Values):

SubstrateKm (μM)Inhibition by Bongkrekic Acid
Coenzyme A (CoA)12.451% at 10 μM
Adenosine 3',5'-diphosphate8.751% at 10 μM
ADP15.9Partial

Mechanism:

  • Exclusively catalyzes counter-exchange transport (e.g., CoA influx for ADP efflux) .

  • No unidirectional transport observed.

Functional Insights

  1. Mitochondrial CoA Import: Primary role involves transporting cytosolic CoA into mitochondria, essential for fatty acid oxidation and TCA cycle .

  2. Regulation: Activity is pH-dependent, optimal at mitochondrial matrix pH (7.8–8.0) .

  3. Inhibitors:

    • Bongkrekic acid: Reduces activity by 51% .

    • Pyridoxal-5′-phosphate: Strong inhibition (82%) .

Research Applications

ApplicationUse CaseSource
Transport AssaysMeasuring CoA/ADP exchange rates in synthetic liposomes
Antibody ProductionGenerating polyclonal antibodies for Western blot/ELISA
Disease ModelingInvestigating mitochondrial disorders linked to CoA deficiency

Comparative Analysis with Orthologs

Recombinant Rat Slc25a42 shares 83% sequence identity with mouse and human variants, but kinetic profiles differ:

SpeciesCoA Transport EfficiencyTissue Expression
RatHigh (Km = 12.4 μM)Liver, kidney, brain
HumanModerate (Km = 15.1 μM)Ubiquitous
MouseHigh (Km = 11.8 μM)Heart, skeletal muscle

Key Research Findings

  1. Liposome Reconstitution: Demonstrated 14C-labeled CoA uptake at 37°C with a Vmax of 1.2 nmol/min/mg protein .

  2. Subcellular Localization: GFP-tagged Slc25a42 colocalizes with mitochondrial markers in CHO cells .

  3. Pathway Involvement: Linked to AMPK signaling and lipid metabolism via CoA shuttling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Slc25a42; Mitochondrial coenzyme A transporter SLC25A42; Solute carrier family 25 member 42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a42
Target Protein Sequence
MDNGVQEGSVRLGEDAEAVLAGAVSTKANHRQVLSSLLSGALAGALAKTAVAPLDRTKII FQVSSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSATMVRVIPYAAIQFSAHEEYKRILGH YYGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISRE EGLKTLYFGFTPTVLGVIPYAGLSFFTYESLKSLHREYSGRPQPYPFERMVFGACAGLIG QSASYPLDVVRRRMQTAGVTGHQHGSILSTLRSIVREEGAVRGLYKGLSMNWLKGPIAVG ISFTTFDLMQILLRQLQS
Uniprot No.

Target Background

Function
A mitochondrial carrier protein facilitating the exchange of coenzyme A (CoA) with intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed. Highly expressed in adipose, followed by hypothalamus and brain coronal sections containing corpus callosum, fornix, thalamus, hypothalamus, optic chiasm, pons, midbrain, and cerebellum.

Q&A

What is Slc25a42 and what is its primary function?

Slc25a42 is a member of the mitochondrial carrier family (SLC25) that transports essential metabolites across the inner mitochondrial membrane. Its primary function is to transport coenzyme A (CoA) and adenosine 3',5'-diphosphate (PAP) into mitochondria in exchange for intramitochondrial (deoxy)adenine nucleotides and adenosine 3',5'-diphosphate . This protein plays a critical role in mitochondrial metabolism by ensuring the availability of CoA within the mitochondrial matrix, where it is required for numerous fundamental processes .

The transport activity is strictly dependent on a counter-exchange mechanism, where the import of one substrate molecule is coupled with the export of another . This characteristic is common among mitochondrial carriers and ensures metabolite balance across the inner mitochondrial membrane.

What are the optimal conditions for expressing recombinant rat Slc25a42 protein?

For optimal expression of recombinant rat Slc25a42:

  • Expression System: The gene should be cloned into a bacterial expression vector (such as pMW7) and expressed in Escherichia coli C0214(DE3) strains .

  • Induction Protocol: Expression should be induced when bacterial culture reaches mid-log phase, typically using IPTG induction .

  • Harvest and Purification: The protein accumulates as inclusion bodies, which can be purified by centrifugation and washing . This approach can yield approximately 55 mg of purified protein per liter of culture .

  • Quality Control: Confirm protein identity by SDS-PAGE analysis (expected molecular mass around 36.2 kDa) and N-terminal sequencing .

  • Storage: Store purified protein at -20°C/-80°C, with aliquoting recommended to avoid repeated freeze-thaw cycles .

ParameterRecommended Condition
Expression SystemE. coli C0214(DE3)
VectorpMW7 or equivalent expression vector
InductionIPTG at mid-log phase
Purification MethodInclusion body isolation, washing
Storage BufferTris-based buffer with 50% glycerol
Storage Temperature-20°C to -80°C

How can I design experiments to measure Slc25a42 transport activity?

To measure transport activity of Slc25a42, the recommended approach is reconstitution into liposomes followed by transport assays:

  • Liposome Reconstitution:

    • Solubilize purified protein in suitable detergent

    • Mix with egg yolk phospholipids

    • Remove detergent using Bio-Beads or equivalent methods

    • The typical protein incorporation rate into liposomes is 20-30% of the added protein

  • Transport Assay Protocol:

    • Pre-load liposomes with specific substrates (e.g., ADP)

    • Initiate transport by adding radiolabeled substrates (e.g., [14C]ADP)

    • Terminate reactions at various time points using inhibitors

    • Separate external substrate using ion-exchange chromatography

    • Measure radioactivity in liposomes for quantification

  • Control Experiments:

    • Include liposomes reconstituted with boiled protein as negative controls

    • Test proteoliposomes reconstituted with unrelated carriers (e.g., Sfc1p, Ort1p) as specificity controls

    • Evaluate potential inhibitors (e.g., pyridoxal-5′-phosphate, bongkrekic acid) to confirm carrier characteristics

  • Data Analysis:

    • Calculate initial transport rates to determine kinetic parameters

    • Analyze substrate specificity by comparing exchange rates with different substrates

    • Determine inhibition profiles by measuring activity in the presence of various inhibitors

This methodological approach provides a robust system for characterizing the transport function of recombinant Slc25a42.

What methods can be used to confirm the subcellular localization of Slc25a42?

Several complementary approaches can be used to confirm the mitochondrial localization of Slc25a42:

  • Fluorescent Protein Fusion:

    • Construct C-terminal EGFP fusion (Slc25a42-EGFP)

    • Transfect mammalian cells (e.g., CHO cells)

    • Co-transfect with a mitochondrial marker (e.g., mtEBFP)

    • Visualize using fluorescence microscopy to confirm co-localization

  • Subcellular Fractionation:

    • Isolate mitochondria using differential centrifugation

    • Analyze fractions by western blotting using Slc25a42-specific antibodies

    • Include markers for mitochondria and other organelles as controls

  • Immunocytochemistry:

    • Use specific antibodies against Slc25a42

    • Co-stain with established mitochondrial markers

    • Analyze using confocal microscopy

  • Protease Protection Assays:

    • Isolate intact mitochondria

    • Treat with proteases in the presence or absence of membrane-disrupting detergents

    • Analyze by western blotting to determine the membrane topology

Research demonstrates that Slc25a42, despite lacking a canonical N-terminal mitochondrial targeting sequence, contains sufficient structural information within its amino acid sequence to ensure proper mitochondrial import . The green fluorescence of GFP-tagged Slc25a42 completely overlaps with mitochondrially targeted BFP, confirming its mitochondrial localization .

What disease phenotypes are associated with Slc25a42 mutations and how can recombinant models help study them?

Mutations in SLC25A42 lead to a form of mitochondrial encephalomyopathy with variable clinical presentations including:

  • Neurological manifestations: Developmental delay, encephalopathy, choreoathetosis movements, and susceptibility to metabolic decompensation

  • Muscle involvement: Myopathy, sometimes leading to severe disability

  • Metabolic abnormalities: Lactic acidosis, elevated lactate levels, and reduced oxygen consumption rates in muscle and fibroblasts

  • Neuroimaging findings: Symmetrical T2 hyperintensity of the putamen with minor volume depression on brain MRI

The severity of symptoms varies widely, even among siblings carrying identical mutations, ranging from mild presentations to severe, life-threatening conditions . This variability suggests complex relationships between genotype and phenotype that require further investigation.

Recombinant models can help study these disease associations through:

  • In vitro functional assays: Testing the impact of disease-associated mutations on transport activity using reconstituted liposomes

  • Cell-based models: Expressing mutant forms in fibroblasts to study effects on CoA levels and mitochondrial function

  • Animal models: Using morpholino-mediated knockdown in zebrafish models followed by rescue experiments with wild-type and mutant human SLC25A42 mRNA

Research shows that zebrafish morphants with reduced Slc25a42 display physical traits and motor deficiencies, and while wild-type human SLC25A42 mRNA can rescue these phenotypes, mutant forms (e.g., p.N291D) fail to restore normal function . This provides a valuable model system for testing potential therapeutic approaches.

How does Slc25a42 deficiency affect mitochondrial metabolism and what are potential therapeutic approaches?

Slc25a42 deficiency impacts mitochondrial metabolism in several ways:

  • Reduced CoA availability: Mutations impair transport of CoA into mitochondria, limiting its availability for key metabolic reactions in the mitochondrial matrix

  • Impaired fatty acid metabolism: As CoA is essential for fatty acid β-oxidation, deficiency particularly affects utilization of fatty acids as energy sources

  • Energy production deficits: Patients show reduced oxygen consumption rates in muscle and fibroblasts, indicating compromised mitochondrial respiration

  • Metabolic stress susceptibility: Patients are especially vulnerable to metabolic decompensation during high energy demand, such as during infections with febrile progression

Potential therapeutic approaches based on recent research include:

  • Pantothenic acid supplementation: High-dose pantothenic acid (vitamin B5) can increase CoA levels in patient-derived fibroblasts, potentially compensating for transport deficits

  • Substrate manipulation strategies: Altering availability of alternative energy substrates may bypass the reliance on fatty acid oxidation

  • Deep brain stimulation: This approach may be beneficial for managing severe dystonia in affected patients

What are the key structural determinants of substrate specificity in Slc25a42 and how can they be experimentally validated?

The substrate specificity of Slc25a42 is determined by several key structural features:

  • Substrate binding pocket: The predicted substrate-binding site shares high homology with ADP/ATP carriers, likely due to structural similarities between CoA and ADP

  • Positively charged regions: The binding region is highly positively charged, facilitating interaction with negatively charged phosphate moieties of substrates

  • Critical residues: Several amino acids are predicted to interact with the adenine base and phosphate groups of CoA, similar to homologous residues in ADP/ATP transporters that are important for substrate binding

A mutation in the residue N291 to aspartate (N291D) is predicted to disrupt substrate binding by introducing a negative charge that may disfavor binding of negatively charged phosphate groups, thereby inhibiting CoA transport .

These structural determinants can be experimentally validated through:

  • Site-directed mutagenesis:

    • Generate recombinant proteins with specific amino acid substitutions

    • Reconstitute in liposomes to measure transport activity

    • Compare kinetic parameters (Km, Vmax) between wild-type and mutant proteins

  • Molecular dynamics simulations:

    • Model protein-substrate interactions

    • Simulate conformational changes during transport cycle

    • Predict effects of mutations on substrate binding and transport

  • Chemical modifications:

    • Use specific chemical modifications to target functional groups in the binding site

    • Correlate modifications with changes in transport activity

  • Cross-linking studies:

    • Use photo-activatable substrate analogs to identify residues in close proximity to the substrate

  • Competitive inhibition assays:

    • Test structural analogs to map the structural requirements for binding

These approaches could help resolve the molecular mechanism of substrate recognition and transport, potentially informing the design of therapeutic interventions for SLC25A42-associated disorders.

How do the properties of rat Slc25a42 compare with orthologs from other species, and what evolutionary insights can be gained?

Comparative analysis of Slc25a42 across species reveals important evolutionary insights:

  • Sequence conservation:

    • The mouse ortholog shares high homology with rat Slc25a42, with only minor differences in amino acid sequence

    • Human SLC25A42 maintains the core functional domains but shows some sequence divergence

    • The N291 residue (mutated in human disease) is conserved across all known orthologs

  • Functional conservation:

    • Human wild-type SLC25A42 mRNA can rescue phenotypes in zebrafish morphants with reduced slc25a42 expression, indicating functional conservation across vertebrates

    • Transport properties appear consistent across species, suggesting evolutionary preservation of the core mechanism

  • Expression patterns:

    • Human SLC25A42 is highly expressed in virtually all tissues, at higher levels than many other SLC25 family members

    • This broad expression pattern suggests a fundamental role in cellular metabolism across tissues

  • Evolutionary context within the SLC25 family:

    • SLC25A42 belongs to a family of carriers that have diversified to transport various metabolites

    • The evolutionary relationship between SLC25A42 and other mitochondrial carriers provides insights into the specialization of mitochondrial metabolism

A comparison table of key properties across species:

PropertyRat Slc25a42Mouse Slc25a42Human SLC25A42Zebrafish slc25a42
Protein Length318 aa 318 aa 318 aa Similar
UniProt IDP0C546 Q8R0Y8 Q86VD7 -
Sequence Identity to Rat100%High (>90%)~83% Lower
LocalizationMitochondrialMitochondrialMitochondrialMitochondrial
Tissue ExpressionBroadBroadAll tissues, highly expressedDevelopmental stage-dependent
FunctionCoA transporterCoA transporterCoA transporterCoA transporter

This evolutionary conservation underscores the fundamental importance of CoA transport in mitochondrial function across diverse species and suggests that insights gained from one species can often be applicable to others.

What are the critical parameters for experimental design when studying Slc25a42 inhibition?

When designing experiments to study Slc25a42 inhibition, researchers should consider these critical parameters:

  • Inhibitor selection and characterization:

    • Based on research, bongkrekic acid partially inhibits SLC25A42 activity (51% inhibition at 10 μM), while carboxyatractyloside has minimal effect (13% inhibition at 10 μM)

    • Pyridoxal-5′-phosphate, bathophenanthroline, tannic acid, bromcresol purple, and mersalyl show more potent inhibition

    • Test concentration ranges based on known IC50 values for related carriers

  • Control variables:

    • Include positive controls (known inhibitors) and negative controls (non-inhibitory compounds)

    • Account for non-specific effects of solvents used to dissolve inhibitors

    • Include unrelated mitochondrial carriers to assess inhibitor specificity

  • Experimental system selection:

    • Purified reconstituted system: Provides direct measurement of carrier inhibition

    • Isolated mitochondria: Allows assessment in a more physiological context

    • Cell-based assays: Evaluates effects on cellular metabolism

    • Animal models: Assesses in vivo relevance

  • Measurement endpoints:

    • Direct transport activity: Using radioisotope-labeled substrates

    • Mitochondrial function: Oxygen consumption, membrane potential

    • Metabolite levels: CoA concentrations in different compartments

    • Physiological outcomes: ATP production, cell viability

  • Statistical considerations:

    • Determine appropriate sample sizes using power analysis

    • Include sufficient replicates (technical and biological)

    • Use appropriate statistical tests for data analysis

A framework for inhibition studies following the principles of sound experimental design :

Design ElementConsiderations for Slc25a42 Inhibition Studies
VariablesIndependent: Inhibitor type and concentration
Dependent: Transport activity, mitochondrial function
Controlled: Temperature, pH, protein concentration
HypothesisSpecific, testable prediction about inhibitor effects
TreatmentsMultiple inhibitor concentrations to establish dose-response
ControlsPositive controls (known inhibitors)
Negative controls (non-inhibitory compounds)
Vehicle controls
RandomizationRandom assignment of samples to treatment groups
ReplicationSufficient technical and biological replicates
MeasurementClearly defined protocols for quantifying inhibition

This structured approach ensures that inhibition studies produce reliable, reproducible results that advance understanding of Slc25a42 function and potential therapeutic interventions.

What are common challenges in working with recombinant Slc25a42 and strategies to overcome them?

Researchers working with recombinant Slc25a42 may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: Slc25a42 forms inclusion bodies when expressed in E. coli

    • Solution: Develop optimized solubilization and refolding protocols or use detergent-based extraction. Alternatively, embrace the inclusion body formation as part of the purification strategy with subsequent reconstitution into liposomes

  • Protein stability concerns:

    • Challenge: Maintaining protein stability during storage and experiments

    • Solution: Store in recommended buffer (Tris-based buffer with 50% glycerol) . Avoid repeated freeze-thaw cycles and store working aliquots at 4°C for up to one week

  • Reconstitution efficiency:

    • Challenge: Variable efficiency of protein incorporation into liposomes

    • Solution: Optimize protein:lipid ratios and detergent removal methods. Typical incorporation rates are 20-30% of added protein

  • Transport activity measurement:

    • Challenge: Low signal-to-noise ratio in transport assays

    • Solution: Optimize substrate concentrations, increase specific activity of radiolabeled substrates, and ensure proper negative controls

  • Functional validation:

    • Challenge: Confirming that the recombinant protein retains native function

    • Solution: Compare kinetic parameters with those measured in isolated mitochondria; use complementation studies in relevant model systems

  • Species-specific differences:

    • Challenge: Variations in properties between rat, human, and other orthologs

    • Solution: Include appropriate species controls and be cautious about extrapolating findings across species

A troubleshooting guide for common technical issues:

IssuePossible CausesRecommended Solutions
Low protein yieldSuboptimal expression conditionsOptimize temperature, induction time, and IPTG concentration
Poor solubilizationInadequate detergent selectionTest different detergents and detergent:protein ratios
Loss of activityProtein denaturationUse gentle purification methods, maintain cold temperature
Variable reconstitutionInconsistent methodologyStandardize reconstitution protocol, measure incorporation
High background in transport assaysNon-specific bindingInclude proper controls, optimize washing steps
Inconsistent inhibition resultsVariable inhibitor solubilityPrepare fresh inhibitor stocks, verify concentrations

How can researchers distinguish between direct effects on Slc25a42 and secondary metabolic consequences in functional studies?

Distinguishing direct effects on Slc25a42 from secondary metabolic consequences requires careful experimental design:

  • Multi-level experimental approach:

    • Isolated system studies: Use purified, reconstituted protein to establish direct effects

    • Cellular studies: Examine effects in cellular contexts to identify metabolic consequences

    • Compare results across systems to differentiate primary and secondary effects

  • Time-course analysis:

    • Primary effects on transport should occur rapidly

    • Secondary metabolic adaptations typically develop over longer timeframes

    • Monitor changes at multiple time points to establish sequence of events

  • Metabolic flux analysis:

    • Use isotope-labeled substrates to track metabolic pathways

    • Compare flux distributions between control and Slc25a42-deficient conditions

    • Identify which pathways are directly versus indirectly affected

  • Genetic rescue experiments:

    • Complement Slc25a42 deficiency with wild-type or mutant proteins

    • Direct effects should be rescued by wild-type protein expression

    • Use structure-informed mutations to affect specific functions

  • Pharmacological approach:

    • Compare effects of direct Slc25a42 inhibitors with inhibitors of related metabolic pathways

    • Use metabolic bypass strategies (e.g., providing alternative substrates)

    • Test whether pantothenic acid supplementation normalizes CoA levels and function

What are emerging research questions and methodological approaches for studying Slc25a42?

Several emerging research questions and innovative methodologies show promise for advancing understanding of Slc25a42:

  • Structural biology approaches:

    • Cryo-electron microscopy to determine high-resolution structures

    • Investigation of conformational changes during transport cycle

    • Structure-guided design of specific inhibitors or activators

  • Advanced genetic models:

    • CRISPR/Cas9-generated tissue-specific knockout models

    • Knock-in models carrying disease-associated mutations

    • Conditional expression systems to study temporal requirements

  • Single-cell analysis:

    • Investigation of cell-to-cell variability in Slc25a42 expression and function

    • Correlation with metabolic states in individual cells

    • Understanding of compensation mechanisms

  • Integrative multi-omics:

    • Combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position Slc25a42 in broader metabolic context

    • Identification of biomarkers for diagnosis and treatment monitoring

  • Therapeutic development:

    • Screening for compounds that enhance mutant Slc25a42 function

    • Development of strategies to increase CoA availability

    • Evaluation of metabolic bypass strategies

  • Clinical correlations:

    • Establishment of genotype-phenotype relationships

    • Investigation of factors influencing clinical variability

    • Long-term follow-up studies to understand disease progression

Key methodological innovations with potential applications to Slc25a42 research include:

Innovative ApproachPotential Application to Slc25a42 Research
Organoid modelsStudy tissue-specific effects of Slc25a42 mutations
Metabolic imagingVisualize CoA distribution in living cells
OptogeneticsControl Slc25a42 activity with light
Systems biologyModel mitochondrial carrier interactions
Mitochondrial-targeted therapiesDevelop carriers to deliver CoA directly to mitochondria
Patient-derived iPSCsCreate disease models from individuals with SLC25A42 mutations

These emerging approaches could address fundamental questions about the regulation of mitochondrial metabolism and provide new avenues for therapeutic intervention in SLC25A42-associated disorders.

How might understanding of Slc25a42 inform broader concepts in mitochondrial carrier biology and disease?

Research on Slc25a42 provides valuable insights that extend to broader concepts in mitochondrial carrier biology and disease:

  • Compartmentalization of metabolism:

    • SLC25A42 exemplifies how carrier-mediated transport maintains distinct metabolite pools

    • This compartmentalization is essential for metabolic regulation and specialization

    • Dysfunction highlights the importance of proper metabolite distribution between cytosol and mitochondria

  • Genetic and clinical heterogeneity:

    • SLC25A42-associated disorders show striking clinical variability even among siblings with identical mutations

    • This heterogeneity may reflect complex interactions with genetic background and environmental factors

    • Understanding these modifiers could inform broader concepts in mitochondrial disease penetrance and expressivity

  • Therapeutic paradigms:

    • The finding that pantothenic acid supplementation increases CoA levels in SLC25A42-deficient cells suggests potential for metabolic bypass therapies

    • This approach may be applicable to other mitochondrial carrier defects

    • Highlights the importance of understanding specific biochemical deficits for targeted interventions

  • Evolutionary insights:

    • Conservation of SLC25A42 across species indicates fundamental importance in metabolism

    • Comparison with other carriers illuminates evolutionary specialization

    • May provide insights into adaptation of energy metabolism across different phylogenetic groups

  • Cancer metabolism:

    • Mitochondrial carriers, including members of the SLC25 family, are altered in cancer cells and contribute to tumorigenesis

    • Understanding normal carrier function provides context for studying metabolic reprogramming in cancer

    • May identify potential therapeutic targets in cancer metabolism

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.