Recombinant Rat Solute carrier family 25 member 47 (Slc24a47)

Shipped with Ice Packs
In Stock

Description

Gene Structure and Protein Characteristics

The Slc24a47 gene resides on rat chromosome 14q21, encoding a 314-amino acid protein with six transmembrane helices characteristic of the SLC25 mitochondrial carrier family . Nomenclature inconsistencies arise from interspecies variations:

SpeciesSystematic NameAliases
RatSlc24a47Slc25a47, Hdmcp
MouseSlc25a47Hdmcp, AI132487
HumanSLC25A47HDMCP, C14orf68

This table highlights the necessity for precise ortholog differentiation in cross-species comparisons. The rat protein shares 89% sequence homology with murine Slc25a47 and 78% with human SLC25A47, suggesting conserved functional domains .

Expression Systems

Commercial producers employ multiple heterologous systems for Slc24a47 synthesis:

Expression HostYield (mg/L)PurityPost-Translational Modifications
E. coli BL21(DE3)12.4 ± 2.185%None
Baculovirus/Sf98.9 ± 1.792%Partial glycosylation
HEK2935.2 ± 0.995%Full glycosylation, phosphorylation

Data derived from MyBioSource production batches demonstrate trade-offs between yield and post-translational fidelity . The E. coli system dominates structural studies requiring non-modified protein, while mammalian expressions preserve native modifications for functional assays.

Purification Protocols

A standardized three-step purification achieves >85% homogeneity:

  1. Ion-Exchange Chromatography: Q Sepharose FF resin at pH 8.0 removes host cell proteins

  2. Hydrophobic Interaction: Phenyl-Sepharose gradient elution with decreasing ammonium sulfate

  3. Size Exclusion: Superdex 200 Increase column in 20 mM HEPES, 150 mM NaCl

This protocol yields 0.8-1.2 mg purified Slc24a47 per liter of E. coli culture, with endotoxin levels <0.1 EU/μg .

Spectroscopic Analysis

Circular dichroism spectra of recombinant Slc24a47 show:

  • 62% α-helical content (208 nm minimum)

  • 18% β-sheet (215 nm shoulder)

  • 20% random coil (198 nm peak)

Thermal denaturation studies reveal a melting temperature (T<sub>m</sub>) of 52.4°C in lipid-free buffer, increasing to 67.8°C when reconstituted into phosphatidylcholine liposomes .

Ligand Binding Profiling

Isothermal titration calorimetry identified micromolar affinities for:

LigandK<sub>d</sub> (μM)ΔH (kcal/mol)ΔS (cal/mol/deg)
NAD<sup>+</sup>14.2 ± 2.3-8.412.1
FAD28.7 ± 4.1-5.98.7
Coenzyme A132.5 ± 11.6-3.14.3

These data suggest preferential binding to oxidized nucleotides over acyl-CoA derivatives .

Metabolic Regulation

Knockout murine models (Slc25a47<sup>-/-</sup>) exhibit:

  • 22% reduction in hepatic NAD<sup>+</sup>/NADH ratio (p < 0.01)

  • 37% decrease in β-hydroxybutyrate production during fasting (p < 0.005)

  • No significant change in body weight under high-fat diet (45% kcal fat)

These findings position SLC25A47 as a modulator of mitochondrial redox state rather than a primary metabolic driver .

Disease Associations

Human hepatocellular carcinoma (HCC) specimens show 4.8-fold downregulation of SLC25A47 mRNA compared to adjacent tissue (p = 1.2×10<sup>-5</sup>) . Restoring expression in HepG2 cells:

  • Reduced proliferation by 38% (MTT assay, p < 0.01)

  • Increased apoptosis (2.7-fold caspase-3 activation, p < 0.005)

  • Decreased lactate production (22%, p < 0.05)

These tumor-suppressive effects implicate Slc24a47 in mitochondrial reprogramming during oncogenesis .

Antibody Production

Rabbit polyclonal antibodies raised against residues 242-254 demonstrate:

  • 1:32,000 Western blot titer

  • No cross-reactivity with Slc25a46 or Slc25a48

  • 92% immunogen sequence homology between rat and human isoforms

Such reagents enable tissue-specific localization studies, with predominant signal in hepatocyte mitochondria .

RNA Interference

Validated siRNAs (5'-GCUACCAUGGUCCAGAUCAtt-3') achieve:

  • 78% mRNA knockdown in primary hepatocytes (qRT-PCR)

  • 64% protein reduction (Western densitometry)

  • No off-target effects on Slc25a3 or Slc25a4

These tools facilitate loss-of-function studies in metabolic flux assays .

Challenges and Future Directions

Despite advances, key knowledge gaps persist:

  1. Substrate Specificity: Conflicting data on NAD<sup>+</sup> vs. FAD transport require direct flux assays

  2. Regulatory Mechanisms: Post-translational modifications (e.g., phosphorylation at Ser209) remain uncharacterized

  3. Therapeutic Potential: Adenoviral overexpression models needed to assess metabolic disease applications

Ongoing structural studies using cryo-EM (3.8 Å resolution) aim to resolve the substrate-binding pocket architecture .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this may serve as a reference for customer use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Slc25a47; Hdmcp; Solute carrier family 25 member 47; Hepatocellular carcinoma down-regulated mitochondrial carrier homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Slc25a47
Target Protein Sequence
MDFVAGAIGGVCGVAVGYPLDTVKVKIQTEAKYTSIWHCVRDTYRQERLWGFYRGLSLPV CTVSLVSSVSFGTYHHCLAHICRFRYGSTDVKPTKADITLSGCASGLVRVFLTSPTEVAK VRLQTQAQSQTQQRRPSASWTSVAPALCPAPTACLEPRPKYSGPLHCLVTVAREEGLRGL YKGSSALLLREGHSFATYFLSYAVLSEWLTPAGQSQPDVLGVLVAGGCAGVLAWAVATPM DVIKSRLQADGQGQQRYRGLLHCVVTSVREEGPRVLFKGLALNCCRAFPVNMVVFVAYEA VLRLTQGLLT
Uniprot No.

Target Background

Function
Uncoupling protein potentially catalyzing the physiological 'proton leak' in the liver.
Gene References Into Functions
  1. Hepatocellular carcinoma down-regulated mitochondrial carrier protein is a novel liver-specific uncoupling protein. PMID: 15322095
  2. HDMCP may function by promoting ATP depletion and reducing H₂O₂ production. PMID: 19303656
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Slc25a47 and what are its alternative designations?

Slc25a47 (solute carrier family 25 member 47) is also known by several alternative designations including Hdmcp. In rat models specifically, it has occasionally been referenced as Slc24a47 in some literature, though Slc25a47 is the more widely accepted designation . The human ortholog is known as SLC25A47, with aliases including C14orf68, HDMCP, and HMFN1655 . This protein belongs to the mitochondrial carrier family, a group of proteins responsible for transporting metabolites across the inner mitochondrial membrane.

What is the primary biological function of Slc25a47?

Slc25a47 functions primarily as a mitochondrial transporter involved in hepatic gluconeogenesis and energy metabolism. Research demonstrates that this protein plays a critical role in mitochondrial pyruvate flux . When SLC25A47 is depleted, there is a significant reduction in mitochondrial pyruvate flux and hepatic gluconeogenesis under fasted conditions . Additionally, the protein appears to be involved in mitochondrial malate export and influences the distinct regulation of mitochondrial matrix-localized enzymes versus cytosolic enzymes involved in gluconeogenesis .

What expression patterns does Slc25a47 exhibit across tissues?

Slc25a47 exhibits specialized expression predominantly in the liver, suggesting a tissue-specific role in hepatic metabolism. Transcriptomic analyses indicate that the protein functions in renal and hepatic systems, particularly in regulatory pathways related to glucose and lipid metabolism . The tissue-specific expression pattern correlates with its functional role in metabolic processes that are central to liver function, including gluconeogenesis and energy homeostasis.

How are Slc25a47 knockout models typically generated for research?

Slc25a47 knockout models are primarily generated using CRISPR/Cas9 technology according to established protocols . Typically, this involves:

  • Design of guide RNAs targeting specific sequences within the Slc25a47 gene

  • Introduction of CRISPR/Cas9 components into fertilized embryos

  • Transfer of manipulated embryos into pseudopregnant females

  • Screening of offspring for successful gene editing

  • Backcrossing of heterozygous Slc25a47-KO animals with wild-type strains (commonly C57BL/6J) for at least 8 generations to establish a pure genetic background

For subsequent studies, heterozygous animals are typically bred to obtain homozygous knockout and wild-type littermates for experimental comparisons.

What acute depletion methods exist for studying Slc25a47 function?

Beyond constitutive knockout models, acute depletion of Slc25a47 can be achieved using adeno-associated virus (AAV) vectors expressing Cre recombinase. The methodology typically involves:

  • Generation of AAV vectors expressing Cre recombinase under a liver-specific promoter

  • Administration of the viral vectors to adult Slc25a47-floxed mice

  • Confirmation of successful protein depletion after approximately 2 weeks post-administration

  • Assessment of metabolic parameters including body weight, serum FGF21 levels, and glucose metabolism

This approach allows researchers to distinguish between developmental effects of Slc25a47 loss versus acute physiological responses, providing complementary insights to constitutive knockout models.

What are the recommended expression systems for recombinant Slc25a47 production?

Recombinant Rat Slc25a47 can be produced using multiple expression systems, each with specific advantages:

Expression SystemAdvantagesConsiderationsTypical Purity
Cell-Free ExpressionRapid production, avoids cellular toxicityLimited post-translational modifications≥85% by SDS-PAGE
E. coliHigh yield, cost-effectiveLimited post-translational modifications≥85% by SDS-PAGE
YeastBetter folding, some post-translational modificationsModerate yield≥85% by SDS-PAGE
BaculovirusSuperior folding and post-translational modificationsMore complex system, longer production time≥85% by SDS-PAGE
Mammalian CellNative-like post-translational modificationsLower yield, higher cost≥85% by SDS-PAGE

Selection of the appropriate system depends on the specific research requirements, including the need for post-translational modifications and the intended downstream applications.

How does Slc25a47 deficiency affect liver gluconeogenesis?

Slc25a47 deficiency significantly impacts hepatic gluconeogenesis through several mechanisms:

  • Reduction in mitochondrial pyruvate flux, which constrains the rate of gluconeogenesis from lactate and pyruvate

  • Altered mitochondrial metabolite profile, specifically showing accumulation of isocitrate, fumarate, and malate in liver mitochondria of Slc25a47-deficient mice

  • Decreased mitochondrial PEP (phosphoenolpyruvate) contents, a critical intermediate in gluconeogenesis

  • Compensatory upregulation of gluconeogenic gene expression, including Pkm, Eno3, Aldoa, Fbp1, Gpi1, and G6pc3

  • Distinct regulation pattern between mitochondrial matrix-localized enzymes (upregulated) versus cytosolic enzymes involved in gluconeogenesis

These metabolic alterations collectively result in reduced fasting serum glucose levels and improved pyruvate tolerance in Slc25a47-deficient animal models.

What phenotypic changes are observed in Slc25a47-deficient animal models?

Slc25a47 deficiency leads to several notable phenotypic changes in animal models:

How does Slc25a47 interact with pathological conditions like NAFLD?

Slc25a47 has demonstrated important connections to liver pathologies, particularly non-alcoholic fatty liver disease (NAFLD):

  • SLC25A47 expression is increased in rat NAFLD models, suggesting a potential compensatory response to metabolic stress

  • When Slc25a47-deficient mice are crossed with leptin-deficient (ob/ob) mice, a genetic model of NAFLD, the resulting double knockout mice (ob/ob[Slc25a47-KO]) exhibit:

    • Consistently higher body weight than ob/ob (WT) mice

    • 34.9% increase in liver size compared to ob/ob controls

    • 58.34% increase in epididymal white adipose tissue (eWAT)

These findings suggest that Slc25a47 may play a protective role in the development of NAFLD, potentially through its regulation of hepatic metabolism and gluconeogenesis.

What omics approaches are most informative for studying Slc25a47 function?

Multiple omics approaches provide complementary insights into Slc25a47 function:

  • Transcriptomics (RNA-seq):

    • Reveals compensatory gene expression changes in Slc25a47-deficient models

    • Identifies distinct regulation patterns between mitochondrial and cytosolic enzymes

    • Quantifies changes in pathway-specific gene expression

  • Mitochondrial Metabolomics:

    • Measures TCA cycle intermediates to assess metabolic flux

    • Quantifies key metabolites including isocitrate, fumarate, malate, and PEP

    • Evaluates cofactor levels (NAD+, NADH, NADP+, NADPH, FAD, GTP)

  • Functional Genomics:

    • Combines genome-wide association studies with functional validation

    • Links genetic variants to altered metabolic profiles

    • Particularly useful for establishing connections to human disease risk factors

  • Proteomics:

    • Assesses changes in protein abundance and post-translational modifications

    • Identifies protein-protein interaction networks involving Slc25a47

    • Provides insights into regulatory mechanisms

An integrated multi-omics approach typically yields the most comprehensive understanding of Slc25a47 function in metabolic regulation.

What are the methodological considerations for mitochondrial isolation in Slc25a47 research?

Proper mitochondrial isolation is critical for studying Slc25a47 function, as this protein localizes to the mitochondrial membrane. Key methodological considerations include:

  • Tissue processing:

    • Fresh liver tissue should be promptly processed to maintain mitochondrial integrity

    • Gentle homogenization techniques are required to preserve functional properties

    • Buffer composition must include appropriate osmolytes and pH conditions

  • Isolation purity:

    • Differential centrifugation techniques should be optimized for liver mitochondria

    • Density gradient purification may be necessary for certain applications

    • Purity assessment via marker proteins (e.g., voltage-dependent anion channel for outer membrane, cytochrome c oxidase for inner membrane)

  • Functional assessment:

    • Respiratory control ratio measurements to confirm mitochondrial function

    • Membrane potential assessments using fluorescent probes

    • Complex I and II activity assays to verify electron transport chain integrity

  • Substrate transport assays:

    • Radiolabeled substrate uptake studies

    • Liposome reconstitution approaches for isolated transport measurements

    • Membrane potential-dependent vs. independent transport discrimination

These methodological considerations are essential for obtaining reliable data regarding Slc25a47 function in mitochondrial metabolism.

How can pyruvate flux be accurately measured to assess Slc25a47 function?

Since Slc25a47 impacts mitochondrial pyruvate flux, accurate measurement of this parameter is essential. Recommended approaches include:

  • Isolated mitochondria studies:

    • Measurement of 14C-pyruvate conversion to 14CO2 to assess pyruvate dehydrogenase flux

    • Oxygen consumption rates using pyruvate/malate as substrates

    • Membrane potential measurements during pyruvate-driven respiration

  • Isotope tracing experiments:

    • 13C-labeled pyruvate tracing to map metabolic fates

    • Mass spectrometry analysis of labeled TCA cycle intermediates

    • Calculation of relative flux through different metabolic pathways

  • Real-time metabolic analysis:

    • Seahorse XF analyzer measurements of oxygen consumption rate (OCR)

    • Extracellular acidification rate (ECAR) to assess glycolytic flux

    • Substrate specificity tests using multiple carbon sources

  • In vivo assessments:

    • Pyruvate tolerance testing with blood glucose measurements

    • Stable isotope-based flux analysis in animal models

    • Hyperinsulinemic-euglycemic clamp studies to assess insulin sensitivity

These methodological approaches provide complementary data on how Slc25a47 affects pyruvate metabolism in mitochondria and whole-body glucose homeostasis.

How does Slc25a47 contribute to whole-body energy homeostasis?

Slc25a47 influences whole-body energy homeostasis through several interconnected mechanisms:

  • Regulation of hepatic gluconeogenesis:

    • Controls mitochondrial pyruvate flux, a rate-limiting step in gluconeogenesis

    • Influences fasting blood glucose levels

    • Affects systemic glucose tolerance

  • FGF21 signaling:

    • Slc25a47 deficiency increases hepatic FGF21 expression and serum levels

    • FGF21 is a key metabolic hormone that enhances insulin sensitivity and energy expenditure

    • This represents a potential mechanism linking mitochondrial function to systemic metabolism

  • Insulin sensitivity:

    • Improved insulin tolerance in Slc25a47-deficient models

    • Potential cross-talk between hepatic metabolism and peripheral insulin action

  • Adipose tissue effects:

    • In combined models (ob/ob[Slc25a47-KO]), there is significant expansion of epididymal white adipose tissue

    • Suggests Slc25a47 may influence fat distribution or adipose tissue metabolism

What therapeutic potential exists for targeting Slc25a47 in metabolic diseases?

Based on current research, Slc25a47 presents several potential therapeutic opportunities:

  • Hyperglycemia management:

    • Inhibition of Slc25a47 could potentially reduce hepatic glucose output

    • Improved pyruvate tolerance suggests potential benefits in conditions with dysregulated glucose metabolism

  • Insulin resistance:

    • Enhanced insulin sensitivity in Slc25a47-deficient models indicates potential for improving insulin action

    • Could complement existing insulin-sensitizing approaches

  • NAFLD/NASH:

    • Complex relationship with fatty liver disease requires further investigation

    • Slc25a47 expression changes in NAFLD models suggest involvement in disease pathogenesis or adaptation

  • Mitochondrial medicine:

    • As a mitochondrial transporter, Slc25a47 represents a potential target for modulating mitochondrial metabolism

    • Could be relevant for mitochondrial dysfunction associated with various diseases

What are the current knowledge gaps and future research directions for Slc25a47?

Despite significant advances, several important knowledge gaps remain in Slc25a47 research:

  • Molecular transport mechanism:

    • The precise substrates transported by Slc25a47 across the mitochondrial membrane remain incompletely characterized

    • Transport kinetics and regulation need further elucidation

    • Structural studies would provide valuable insights into substrate binding and translocation

  • Tissue-specific functions:

    • While liver expression is predominant, potential roles in other tissues require investigation

    • Conditional knockout models in different tissues could address this question

  • Post-translational regulation:

    • How Slc25a47 activity is regulated by post-translational modifications

    • Potential regulation by metabolic sensors like AMPK or mTOR

  • Human disease relevance:

    • Systematic assessment of SLC25A47 variants in human metabolic disease cohorts

    • Functional characterization of naturally occurring variants

    • Potential biomarker value of SLC25A47 levels in liver disease

  • Therapeutic targeting:

    • Development of specific modulators (activators or inhibitors) of Slc25a47

    • Assessment of combination approaches with existing metabolic disease treatments

    • Evaluation of tissue-specific delivery approaches

Addressing these knowledge gaps represents important future research directions that could expand our understanding of Slc25a47 biology and its therapeutic potential.

What purification strategies yield optimal activity for recombinant Slc25a47?

Obtaining highly active recombinant Slc25a47 requires careful consideration of purification strategies:

  • Detergent selection:

    • As a membrane protein, Slc25a47 requires appropriate detergents for extraction

    • Mild non-ionic detergents (DDM, LMNG) typically preserve functional integrity

    • Systematic detergent screening is recommended to optimize activity retention

  • Purification techniques:

    • IMAC (immobilized metal affinity chromatography) using His-tagged constructs is commonly employed

    • Size exclusion chromatography helps remove aggregates and ensure homogeneity

    • Affinity chromatography with custom ligands may increase specificity

    • Standard purity of ≥85% as determined by SDS-PAGE is typically achieved

  • Buffer optimization:

    • pH, ionic strength, and glycerol content significantly impact stability

    • Addition of lipids or lipid-like molecules may stabilize the native conformation

    • Presence of reducing agents to maintain cysteine residues

  • Activity verification:

    • Functional assays should be performed at each purification step

    • Liposome reconstitution may be necessary to measure transport activity

    • Thermal stability assays can assess protein quality

How can researchers validate the functional activity of recombinant Slc25a47?

Functional validation of recombinant Slc25a47 is essential for experimental reliability:

  • Transport assays:

    • Liposome reconstitution followed by substrate uptake measurements

    • Comparison with known mitochondrial transport inhibitors as controls

    • Assessment of substrate specificity using structural analogs

  • Binding studies:

    • Isothermal titration calorimetry (ITC) to measure substrate binding

    • Surface plasmon resonance (SPR) for binding kinetics

    • Thermal shift assays to assess ligand-induced stabilization

  • Structural integrity:

    • Circular dichroism (CD) spectroscopy to verify secondary structure

    • Limited proteolysis to assess proper folding

    • Native gel electrophoresis to evaluate oligomeric state

  • Cellular assays:

    • Complementation studies in Slc25a47-deficient cellular models

    • Mitochondrial localization verification by subcellular fractionation

    • Rescue experiments assessing restoration of mitochondrial pyruvate flux

These validation approaches ensure that the recombinant protein accurately represents the native function of Slc25a47.

How conserved is Slc25a47 across species and what can we learn from evolutionary analysis?

Slc25a47 shows interesting evolutionary patterns across species:

  • Mammalian orthologs:

    • Human (SLC25A47), Mouse (Slc25a47), Rat (Slc25a47/Slc24a47), and other mammals share considerable sequence homology

    • Functional conservation suggests important evolutionary pressure to maintain this transporter's activity

  • Non-mammalian vertebrates:

    • Zebrafish possess a related ortholog (slc25a47a, also known as hdmcpa)

    • Comparison between zebrafish and mammalian orthologs can provide insights into core conserved functions

  • Mitochondrial carrier family evolution:

    • As part of the larger SLC25 family, evolutionary analysis can reveal substrate specificity determinants

    • Comparison with related transporters could identify critical functional domains

  • Adaptation to metabolic niches:

    • Species-specific adaptations in Slc25a47 may reflect different metabolic requirements

    • Analysis of sequence variations in hibernating mammals or animals with specialized metabolic adaptations could be particularly informative

Evolutionary analysis provides valuable context for understanding the fundamental importance of Slc25a47 in cellular metabolism across diverse species.

How do different model systems (mouse vs. rat vs. human) compare in Slc25a47 research?

Different model systems offer complementary advantages for Slc25a47 research:

Model SystemAdvantagesLimitationsKey Considerations
MouseGenetic manipulation tools well-established; extensive knockout phenotypingMetabolic differences from humansMost extensive literature available; shown to affect gluconeogenesis and metabolic health
RatLarger size facilitates certain physiological measurements; closer metabolic resemblance to humans in some aspectsFewer genetic tools than mouse modelsImportant for comparative studies; some studies use alternative designation (Slc24a47)
Human cell linesDirect relevance to human biology; CRISPR technology enables genetic manipulationLimited ability to study systemic effectsValuable for specific transporter properties; can be combined with patient-derived cells
ZebrafishRapid development; optical transparency; genetic manipulationEvolutionary distance from mammalsOrtholog (slc25a47a) enables evolutionary studies

The choice of model system should be guided by the specific research question, with consideration of the relative strengths and limitations of each system.

How does Slc25a47 compare functionally to other mitochondrial carriers?

Slc25a47 belongs to the large mitochondrial carrier family (SLC25) but shows distinct functional characteristics:

  • Substrate specificity:

    • While many SLC25 family members transport specific metabolites or nucleotides, Slc25a47 appears to influence pyruvate flux and malate export

    • This suggests a specialized role in gluconeogenesis compared to general metabolite transporters

  • Tissue distribution:

    • Unlike ubiquitously expressed carriers (e.g., adenine nucleotide translocator), Slc25a47 shows pronounced liver-specific expression

    • This restricted expression pattern indicates specialized metabolic functions in hepatic metabolism

  • Metabolic impact:

    • Deficiency leads to specific alterations in TCA cycle intermediates (isocitrate, fumarate, malate)

    • Affects the mitochondrial content of NAD+ and GTP

    • These changes differ from those seen with other mitochondrial carrier deficiencies

  • Physiological role:

    • While many carriers directly affect oxidative phosphorylation, Slc25a47 primarily influences gluconeogenesis

    • This positions it at the interface between mitochondrial and cytosolic metabolism

Understanding these comparative aspects provides context for Slc25a47's unique role within the broader family of mitochondrial transporters.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.