Recombinant Rat Somatostatin receptor type 1 (Sstr1)

Shipped with Ice Packs
In Stock

Description

Functional Role and Signaling Mechanisms

Sstr1 mediates multiple signaling pathways via G-protein coupling:

PathwayMechanismKey Findings
cAMP inhibitionPertussis toxin-sensitive Gαi3 coupling reduces adenylyl cyclase activity ED50 = 1.0 nM for somatostatin-14 in CHO cells
Phosphotyrosine phosphatase activationPertussis toxin-insensitive G proteins stimulate Na+/H+ exchange EC50 = 70 nM in SSTR1-transfected cells
Inositol trisphosphate synthesisGq-mediated PLC activation increases intracellular Ca²⁺ Dose-dependent response (ED50 = 40 nM) blocked by PTX

Structural studies reveal:

  • A conserved orthosteric binding pocket accommodating panagonists like pasireotide .

  • Transmembrane helices TM3 and TM7 critical for ligand selectivity .

3.1. Drug Development

Cryo-EM structures of Sstr1 bound to pasireotide (FDA-approved panagonist) identified:

  • A hydrophobic cleft in TM2–TM7 enabling high-affinity ligand docking .

  • Residues Q102³²⁹ and D122³⁴⁹ as key determinants for agonist efficacy .

3.2. Developmental Biology

  • Embryonic expression: Sstr1 mRNA peaks at gestational day 14 in rat neural tissues, correlating with neurogenesis .

  • Pancreatic role: Detectable protein in pancreatic primordia by E17, suggesting involvement in endocrine development .

3.3. Molecular Dynamics (MD) Insights

  • Ligands like compound 22 form stable H-bonds with residues D122³⁴⁹ and Q102³²⁹ (RMSF = 0.29 nm) .

  • Bulky substituents at the ligand’s 4′-position reduce activity due to steric clashes in the binding pocket .

Challenges and Future Directions

  • Selectivity limitation: Current agonists exhibit off-target effects on SSTR3/SSTR5 due to shared binding motifs .

  • Therapeutic potential: Structure-guided design of subtype-selective ligands could improve neuroendocrine tumor treatments .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for precise delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
In general, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Sstr1; Somatostatin receptor type 1; SS-1-R; SS1-R; SS1R; SRIF-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MFPNGTAPSPTSSPSSSPGGCGEGVCSRGPGSGAADGMEEPGRNSSQNGTLSEGQGSAIL ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS RAYSVEDFQPENLESGGVFRNGTCASRISTL
Uniprot No.

Target Background

Function
Somatostatin receptor type 1 (Sstr1) is a receptor for somatostatin with a higher affinity for somatostatin-14 compared to -28. This receptor is coupled to phosphotyrosine phosphatase and Na(+)/H(+) exchanger via pertussis toxin-insensitive G proteins.
Gene References Into Functions
  1. In the jejunums of Cryptosporidium parvum-infected rats, daily octreotide therapy decreased SSTR1 mRNA levels on day 14 post-infection, although it increased SSTR1 mRNA levels on day 50 post-infection. Specific SSTRs may regulate the inflammatory pathway in this rat intestinal inflammation model. PMID: 29522573
  2. All SSTR1-5 proteins were observed at embryonic day 10 and increased with time in major structures, but the localization varied between the different subtypes. Only SSTR1 protein co-localized to a higher extent with the islet hormones studied. PMID: 25926390
  3. Up-regulated SSTR1 contributed to neuronal apoptosis after intracerebral hemorrhage, accompanied by reduced expression of bcl-2. PMID: 25035058
  4. This study demonstrated that sstr1 and Melanin-concentrating hormone co-localize in neurons in the lateral hypothalamus (LH) and zona incerta (ZI), while MCHR1 mRNA is widely expressed throughout the brain. PMID: 24978951
  5. Most neuropeptide Y expressing receptors in the arcuate nucleus coexpress somatostatin receptor subtype 1. PMID: 15618885
  6. Data suggest that higher expression of somatostatin receptor subtype 1 and 2 mRNA induced by the gsp oncogene may be a mechanism by which gsp-positive tumors show a greater response to somatostatin. PMID: 16379030
  7. The sequential activation of JAK2, SHP-2, and Src conveys the molecular signaling from SSTR1 to the activation of this phosphatase, which is responsible for the final biological effects of SST. PMID: 17021051
  8. Sstr1 mediates a dynamic process of endocytosis, recycling, and re-endocytosis of its cognate ligand. PMID: 17170097
  9. All five SSTR are expressed in splanchnic blood vessels. Cirrhosis reduces expression of SSTR1 in the portal vein. PMID: 17617126
  10. The combined activation of SSTR1 and -2 shows a partial synergism as far as antiproliferative activity. PMID: 18566118
  11. Postsynaptic localization of sst(1) receptors and synaptic connectivity in the ARC undergo pronounced remodeling in parallel with the GH rhythm. PMID: 19553459

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, pituitary, islet, jejunum, stomach, heart, spleen.

Q&A

What is the molecular structure of rat Sstr1 and how does it compare to other species?

Rat Somatostatin Receptor Type 1 (Sstr1) belongs to the G-protein coupled receptor (GPCR) family characterized by seven transmembrane domains. The receptor exhibits high-affinity binding to several radioiodinated somatostatin (SRIF) analogues, with specific pharmacological properties determined through multiple radioligand binding studies . Structurally, Sstr1 shares conserved binding patterns with other somatostatin receptors, though it possesses unique features that contribute to its specific signaling properties. Recent cryoelectron microscopy studies have revealed detailed structural information about the receptor when bound to various ligands, providing insights into its functional domains .

What are the primary signaling pathways associated with rat Sstr1?

Rat Sstr1 primarily couples to pertussis toxin-sensitive G proteins (Gi alpha 1,2) to inhibit adenylyl cyclase activity. When activated, Sstr1 inhibits forskolin-stimulated cAMP accumulation by up to 50% in a dose-dependent manner with an ED50 of approximately 1.1 nM . This inhibitory effect is significantly reduced (from 50% to 22%) following pertussis toxin treatment, confirming the receptor's coupling to Gi/Go proteins . Additionally, Sstr1 activation triggers intracellular calcium mobilization, though this occurs through different mechanisms compared to other somatostatin receptor subtypes .

How is Sstr1 expression regulated in different tissues?

Sstr1 expression shows distinct tissue distribution patterns that can be influenced by hormonal and metabolic conditions. The receptor is expressed in various tissues including the central nervous system, endocrine glands, and specific peripheral tissues. Expression levels are differentially regulated in a tissue-specific manner (central vs. systemic) and can be modulated by changes in the hormonal/metabolic environment . Studies have demonstrated that factors such as fasting and obesity can alter Sstr1 expression patterns in a tissue-specific manner, suggesting complex regulatory mechanisms that influence receptor availability under various physiological conditions .

What are the most effective expression systems for studying recombinant rat Sstr1?

Chinese hamster ovary (CHO) cells (particularly the K1 strain) have proven to be an effective expression system for studying recombinant rat Sstr1 . When transfected with Sstr1 cDNA, these cells express functional receptors that exhibit saturable, high-affinity binding to somatostatin analogues. The CHO-K1 system allows for detailed pharmacological characterization and signal transduction studies .

For optimal expression and functionality assessment, the following protocol parameters are critical:

ParameterRecommended ConditionsNotes
Cell LineCHO-K1Provides consistent expression and pharmacological profiles
Transfection MethodLipid-based transfectionOptimized for GPCRs
Selection AgentG418 (400-800 μg/ml)For stable transfectants
Expression VerificationRadioligand binding assaysUsing [125I-Tyr11]SRIF-14
Functional AssayscAMP inhibitionMeasure forskolin-stimulated cAMP levels
G-protein CouplingPertussis toxin treatmentTo verify Gi/Go protein involvement

How should researchers optimize radioligand binding assays for rat Sstr1?

For optimal radioligand binding characterization of rat Sstr1, researchers should employ multiple radioligands to comprehensively determine the receptor's pharmacological properties. Three distinct radioligands have been successfully used: [125I-Tyr11]SRIF-14 (125I-S-14), [Leu8,D-Trp22,125I-Tyr25], and other iodinated somatostatin analogs .

Key methodological considerations include:

  • Membrane preparation: Isolate cell membranes from transfected cells expressing rat Sstr1 using proper buffer conditions (typically containing protease inhibitors).

  • Saturation binding experiments: Use increasing concentrations of radioligand to determine Bmax and Kd values.

  • Competition binding assays: Employ various unlabeled somatostatin analogs to establish the pharmacological profile.

  • G-protein involvement: Include GTPγS in binding assays to assess the influence of G-protein coupling on ligand binding.

  • Pertussis toxin treatments: Pre-treat cells with pertussis toxin (100-200 ng/ml for 16-24 hours) to evaluate the role of Gi/Go proteins in modulating binding characteristics .

What methods are most appropriate for studying Sstr1-mediated signaling?

Several complementary approaches should be employed to comprehensively characterize Sstr1-mediated signaling:

  • cAMP Accumulation Assays: Measure inhibition of forskolin-stimulated cAMP production using radioimmunoassay or ELISA-based methods. This approach can reveal the dose-dependent effects of somatostatin and its analogs (ED50 ≈ 1.1 nM for SRIF) .

  • G-protein Activation Studies: Assess G-protein coupling through:

    • [35S]GTPγS binding assays to directly measure G-protein activation

    • Immunoprecipitation techniques using antisera specific for different G-protein subunits (e.g., Gi alpha 1,2)

    • Pertussis toxin sensitivity experiments to confirm Gi/Go protein involvement

  • Calcium Mobilization: Monitor changes in intracellular calcium concentration ([Ca2+]i) using fluorescent calcium indicators like Fura-2. This is particularly relevant as truncated variants of somatostatin receptors can mediate ligand-selective induced variations in [Ca2+]i despite being structurally different from the full-length receptor .

  • Statistical Analysis: Apply appropriate statistical tests (one- or two-way ANOVA followed by Newman-Keuls test or Student's t-test) with significance set at P < 0.05. For single-cell analyses, a minimum of 20 cells should be analyzed per experiment .

How do truncated Sstr1 variants differ functionally from the canonical receptor?

Recent research has identified truncated but functional variants of somatostatin receptors, though more extensive work has been done on sst5 variants than on Sstr1 specifically. These truncated receptors contain fewer than the typical seven transmembrane domains but retain functional signaling capabilities .

Key differences between truncated variants and canonical receptors include:

  • Subcellular Localization: Truncated variants display preferential intracellular distribution compared to the predominantly membrane-localized full-length receptors .

  • Ligand Selectivity: These variants can exhibit unique ligand-selective signaling properties, potentially contributing to the complex and distinct pathophysiological roles of somatostatin and cortistatin .

  • Tissue Distribution: While truncated variants largely share the tissue distribution of full-length receptors, they exhibit unique differences that may be functionally significant .

  • Regulation: Truncated variants are differentially regulated by changes in the hormonal/metabolic environment in a tissue-dependent and ligand-dependent manner, suggesting distinct roles in physiological adaptation .

Understanding these truncated variants is essential for fully elucidating the complex signaling mechanisms of the somatostatin receptor system.

What computational approaches are most effective for modeling Sstr1-ligand interactions?

Advanced computational approaches have proven valuable for understanding Sstr1-ligand interactions:

How does the binding mechanism of pasireotide to Sstr1 differ from other somatostatin analogs?

Recent cryoelectron microscopy studies have revealed distinct binding patterns of pasireotide (a clinically approved panagonist) to Sstr1 compared to other somatostatin analogs:

  • Extended Binding Pocket: Pasireotide binds to a conserved extended binding pocket in Sstr1, which differs from the binding patterns of other analogs such as SST14, octreotide, and lanreotide .

  • Conservation Across Subtypes: The pasireotide binding pattern shows conservation across somatostatin receptor subtypes, which explains its panagonist properties .

  • Structural Adaptations: The binding of pasireotide induces specific conformational changes in the receptor that differ from those induced by subtype-selective agonists like L-797591 (Sstr1-selective) and L-796778 .

  • Activation Mechanisms: The pasireotide-induced activation of G-protein coupling reveals both conserved and diverse mechanisms across different SSTR subtypes, providing insights into the molecular basis of ligand selectivity .

Understanding these differential binding mechanisms is crucial for the rational design of more selective SSTR subtype-specific drugs with enhanced efficacy and reduced side effects.

How can researchers address common challenges in Sstr1 expression systems?

Researchers frequently encounter several challenges when working with Sstr1 expression systems:

  • Variable Expression Levels: To ensure consistent expression:

    • Establish stable cell lines with verified receptor expression

    • Perform regular monitoring of receptor levels using binding assays

    • Consider inducible expression systems for controlled receptor production

  • Receptor Functionality Assessment: Verify receptor functionality through:

    • Dose-response curves for cAMP inhibition (ED50 should be approximately 1.1 nM for SRIF)

    • Pertussis toxin sensitivity tests (expect 80% reduction in binding following PTX treatment)

    • G-protein coupling verification using immunoprecipitation with Gi alpha 1,2-specific antisera

  • Species-Specific Differences: Be aware that findings from rat Sstr1 may not directly translate to human or other species' Sstr1 due to structural and functional variations. Cross-species validation is recommended for translational research applications.

What are the critical parameters for verifying G-protein coupling to rat Sstr1?

Verifying G-protein coupling to rat Sstr1 requires assessment of multiple parameters:

  • Pertussis Toxin Sensitivity: Treatment with pertussis toxin should decrease radioligand binding by approximately 80%, confirming the involvement of Gi/Go proteins . Additionally, PTX treatment should reduce both the efficacy and potency of SRIF-mediated inhibition of cAMP accumulation (from 50% to 22%) .

  • Immunoprecipitation Studies: Immunoprecipitation of 125I-S-14 binding should be observed with antisera specific for Gi alpha 1,2, but not with antisera specific for Gs alpha in membranes from transfected cells .

  • Functional Readouts: The inhibition of forskolin-stimulated cAMP accumulation (by up to 50%) in a dose-dependent manner (ED50 = 1.1 nM) serves as a functional confirmation of proper G-protein coupling .

  • GTPγS Binding: Enhanced binding of [35S]GTPγS in response to Sstr1 activation provides direct evidence of G-protein coupling efficacy.

Verification MethodExpected ResultInterpretation
Pertussis Toxin~80% reduction in bindingConfirms Gi/Go involvement
cAMP Inhibition50% inhibition, ED50 1.1 nMFunctional G-protein signaling
PTX Effect on cAMPReduction to 22% inhibitionQuantifies Gi/Go contribution
ImmunoprecipitationPositive with Gi alpha 1,2 antiseraIdentifies specific G-protein subtypes
Negative with Gs alpha antiseraConfirms specificity of coupling

How should researchers interpret contradictory findings between in vitro and in vivo Sstr1 studies?

When encountering contradictions between in vitro and in vivo Sstr1 studies, researchers should consider several factors:

  • Receptor Variant Expression: The presence of truncated receptor variants may influence signaling outcomes. These variants display unique properties including preferential intracellular distribution and ligand-selective signaling that may not be captured in simplified in vitro systems .

  • Tissue-Specific Regulation: Sstr1 expression and function are differentially regulated in a tissue-dependent manner and can be influenced by hormonal/metabolic changes . In vitro systems may not replicate these complex regulatory mechanisms.

  • Experimental Design Considerations:

    • Statistical analysis should include appropriate tests (one- or two-way ANOVA with post-hoc testing) with significance set at P < 0.05

    • In vivo studies should include sufficient animals per group (minimum of five)

    • In vitro experiments should be performed in at least three separate, independent experiments on different days with different cell preparations

    • For single-cell analyses, a minimum of 20 cells should be analyzed per experiment

  • Mixed Receptor Populations: In vivo systems may express multiple somatostatin receptor subtypes that can form heterodimers or otherwise influence each other's signaling, creating more complex signaling patterns than observed in isolated receptor expression systems.

What novel methodologies are emerging for studying Sstr1 structure-function relationships?

Several cutting-edge approaches are advancing our understanding of Sstr1 structure-function relationships:

  • Cryo-Electron Microscopy (Cryo-EM): Recent breakthroughs using cryo-EM have revealed detailed structural information about Sstr1 when bound to various ligands, including the FDA-approved panagonist pasireotide and subtype-selective agonists such as L-797591 . This approach allows visualization of the receptor in various conformational states, providing insights into activation mechanisms.

  • Molecular Dynamics with Enhanced Sampling: Advanced computational techniques can elucidate conformational changes, binding energetics, and allosteric communication networks within Sstr1. These approaches include metadynamics, umbrella sampling, and Markov state modeling to explore the energy landscape of receptor-ligand interactions.

  • High-Throughput Mutagenesis Combined with Functional Assays: Systematic mutation of key residues identified through structural studies (such as those in the extracellular loop from R197 to E214) coupled with functional assays can systematically map the contribution of specific amino acids to ligand binding and receptor activation.

  • Biased Signaling Analysis: New methodologies to characterize biased signaling (preferential activation of specific downstream pathways) can help identify ligands with tailored signaling profiles, potentially leading to more selective therapeutic agents.

How might understanding Sstr1 splice variants impact receptor biology and drug development?

The discovery of truncated but functional somatostatin receptor variants opens new research avenues with significant implications:

  • Expanded Signaling Diversity: Truncated variants exhibit unique ligand-selective signaling properties that may contribute to the complex and distinct pathophysiological roles of somatostatin and cortistatin . Understanding these variants could explain previously unexplained effects of these peptides.

  • Tissue-Specific Targeting: Given that truncated variants show distinct tissue distribution patterns and are differentially regulated by hormonal/metabolic changes , drugs could potentially be developed to target specific variants in select tissues.

  • Diagnostic Applications: The differential expression of receptor variants in normal versus pathological states could serve as biomarkers for disease diagnosis or progression monitoring.

  • Pharmacological Implications: Current drug screening approaches typically focus on canonical receptors. Incorporating variant-specific screening could identify compounds with unique signaling profiles and potentially fewer side effects by targeting specific variant-mediated pathways.

  • Rational Drug Design: Structural insights into these variants could guide the development of drugs that selectively target specific receptor conformations or binding sites unique to particular variants.

What role might systems biology approaches play in understanding Sstr1 signaling networks?

Systems biology approaches offer powerful tools for comprehensively understanding Sstr1 signaling within broader cellular networks:

  • Integrated Multi-Omics Analysis: Combining transcriptomics, proteomics, and metabolomics data can provide a comprehensive view of how Sstr1 activation influences cellular processes across different tissues and under various physiological conditions.

  • Network Pharmacology: Mapping the interactions between Sstr1 and other signaling nodes can reveal unexpected connections and potential off-target effects of Sstr1-targeted drugs. This approach can identify signaling hubs that might be more effectively targeted for therapeutic purposes.

  • Computational Modeling of Signaling Cascades: Developing quantitative models of Sstr1 signaling pathways, including G-protein activation, cAMP inhibition, and calcium mobilization, can predict cellular responses to different ligands and receptor variants under various conditions.

  • In Silico Clinical Trials: Advanced modeling approaches can simulate patient responses to Sstr1-targeted therapies based on receptor variant expression patterns, potentially accelerating clinical development and improving patient stratification.

  • Artificial Intelligence Applications: Machine learning algorithms can identify patterns in large datasets related to Sstr1 signaling, potentially uncovering novel regulatory mechanisms and predicting drug responses based on receptor expression profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.