Recombinant Rat Somatostatin receptor type 3 (Sstr3)

Shipped with Ice Packs
In Stock

Description

Hormone Regulation

  • Growth Hormone (GH) Suppression: Constitutive Sstr3 activity in rat pituitary cells suppresses GH synthesis by reducing cAMP/PKA signaling. This occurs via GSK3-β activation, which phosphorylates the transcription factor Pit-1, reducing its binding to the GH promoter .

  • Somatostatin Signaling: Sstr3 inhibits hormone secretion (e.g., GH, insulin) and cell proliferation in endocrine tissues .

Immune Modulation

  • T-Cell Regulation: Recombinant somatostatin binding to Sstr3 reduces human T-cell proliferation by suppressing mitochondrial respiration and IL-2 production. This effect is mediated via Sstr3-dependent GSK3 activation .

    • Mechanism: Sstr3 activation decreases phosphorylated GSK3 (inactive form), enhancing GSK3’s ability to limit T-cell responses .

Neurological and Metabolic Roles

  • Sstr3 localizes to neuronal cilia and is implicated in object recognition memory .

  • It modulates insulin availability and glucose homeostasis through indirect pathways .

Key Studies

Study FocusMethodsKey FindingsReference
T-Cell MetabolismIn vitro human T-cell assaysSST-Sstr3-GSK3 axis reduces mitochondrial respiration and IFN-γ expression
Pituitary Tumor ModelMENX rat model + ITF2984 agonistSstr3 activation suppressed NFPA growth in female rats with high Sstr3 expression
GH SynthesisRat GC cell transfectionConstitutive Sstr3 activity inhibits GH transcription via cAMP/PKA/GSK3-β

Ligand Interactions

  • Pasireotide: A pan-SSTR agonist binds Sstr3 via a conserved extended pocket, activating Gi-protein signaling .

  • ITF2984: A selective Sstr3 full agonist with 10-fold higher affinity than octreotide, showing efficacy in NFPA treatment .

Therapeutic Applications

  • Neuroendocrine Tumors: Sstr3 is highly expressed in nonfunctioning pituitary adenomas (NFPAs). ITF2984, a selective agonist, reduces tumor growth in preclinical models .

  • Immune Disorders: Targeting the Sstr3-GSK3 pathway could modulate autoimmune or inflammatory conditions by dampening T-cell responses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery time estimates.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please notify us in advance, as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Sstr3; Somatostatin receptor type 3; SS-3-R; SS3-R; SS3R; SSR-28
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-428
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sstr3
Target Protein Sequence
MAAVTYPSSVPTTLDPGNASSAWPLDTSLGNASAGTSLAGLAVSGILISLVYLVVCVVGL LGNSLVIYVVLRHTSSPSVTSVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLV MAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARMVSAAVWVASAVVVLPVV VFSGVPRGMSTCHMQWPEPAAAWRTAFIIYTAALGFFGPLLVICLCYLLIVVKVRSTTRR VRAPSCQWVQAPACQRRRRSERRVTRMVVAVVALFVLCWMPFYLLNIVNVVCPLPEEPAF FGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRILLRPSRRVRSQEPGSGPPEKTEEE EDEEEEERREEEERRMQRGQEMNGRLSQIAQPGPSGQQQRPCTGTAKEQQLLPQEATAGD KASTLSHL
Uniprot No.

Target Background

Function
Somatostatin receptor type 3 (SSTR3) serves as a receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin-sensitive G proteins to the inhibition of adenylyl cyclase.
Gene References Into Functions
  1. In the jejunums of Cryptosporidium parvum-infected rats, daily octreotide therapy increased mRNA levels of SSTR3 on day 50 post-infection. Specific SSTRs may regulate the inflammatory pathway in this rat intestinal inflammation model. PMID: 29522573
  2. SSTR3 was significantly up-regulated after intracerebral hemorrhage, accompanied by neuronal apoptosis. PMID: 28176050
  3. Identification of a plasma membrane targeting sequence of rat somatostatin receptor subtype 3 (somatostatin receptor 3) PMID: 11935411
  4. SST-14 was cointernalized with SSTR3, uncoupled from the receptor, and sorted into an endocytic degradation pathway, while octreotide was recycled as an intact peptide. Chronic stimulation of SSTR3 induced time-dependent downregulation of the receptor. PMID: 18702662
  5. The R-type calcium channel does not mediate the effects of somatostatin receptor 3 on insulin secretion in INS-1 cells. PMID: 18793718
  6. This study examined the embryonic and postnatal development of SSTR3 expression in the hippocampal formation and its association with newly born and mature neurons in adult rats. PMID: 18992731

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Note=Internalized into endoplasmic vesicles upon somatostatin-stimulation.
Tissue Specificity
Densely expressed in cerebellum and at moderate levels in the amygdala, cortex, striatum, spleen, liver and pituitary.

Q&A

What is the basic structure and function of rat Somatostatin receptor type 3?

Rat Somatostatin receptor type 3 (Sstr3) is a G protein-coupled receptor (GPCR) belonging to the Class A (Rhodopsin) Peptide receptors family. The protein consists of seven transmembrane domains (TM1-TM7), three extracellular loops (ECL1-ECL3), and three intracellular loops (ICL1-ICL3) . Functionally, Sstr3 acts as a receptor for both somatostatin-14 and somatostatin-28 peptides. Upon ligand binding, this receptor couples via pertussis toxin-sensitive G proteins to inhibit adenylyl cyclase activity, thereby regulating various cellular responses . The full sequence analysis reveals specific amino acid patterns that contribute to its binding properties and signaling mechanisms. Understanding these structural elements is crucial for designing targeted experimental approaches and interpreting receptor pharmacology.

How does rat Sstr3 differ from other somatostatin receptor subtypes?

Rat Sstr3 represents one of five distinct somatostatin receptor subtypes (Sstr1-5), each with unique structural features and signaling properties. While all subtypes bind somatostatin peptides, Sstr3 demonstrates distinct pharmacological profiles compared to other subtypes. The amino acid sequence of rat Sstr3 shows characteristic patterns, especially in the transmembrane domains and intracellular loops that determine its signaling specificity . Unlike some other subtypes, Sstr3 predominantly couples to adenylyl cyclase inhibition pathways through Gi/o proteins . The extracellular domain structure, particularly in the N-terminal region and ECL2, contributes to its ligand selectivity. Researchers should consider these distinctive properties when designing subtype-specific studies or when interpreting cross-reactivity in experimental systems.

What are the validated alternative names and identifiers for rat Sstr3 in scientific literature?

When conducting literature searches or database queries for rat Sstr3, researchers should be aware of its various alternative nomenclature to ensure comprehensive results. The validated alternative designations include: Somatostatin receptor type 3, SS-3-R, SS3-R, SS3R, SST3, and SSR-28 . The official gene symbol is Sstr3, which is consistently used in genomic databases for Rattus norvegicus . Using consistent terminology in publications helps maintain clarity in scientific communication. When reporting experimental findings, it's advisable to include multiple identifiers to facilitate cross-referencing across different research platforms and databases.

What expression systems are most effective for producing functional recombinant rat Sstr3?

The selection of an appropriate expression system is critical for obtaining functional recombinant rat Sstr3. For mammalian membrane proteins like GPCRs, mammalian cell lines often provide the most suitable environment for proper folding and post-translational modifications. HEK293 and CHO cell lines have demonstrated successful expression of functional rat Sstr3 with appropriate trafficking to the plasma membrane. These systems support the complex disulfide bond formation and glycosylation patterns required for proper receptor function. When designing expression constructs, researchers should consider incorporating epitope tags (such as FLAG or His-tags) at positions that do not interfere with ligand binding or signaling domains. The expression construct should include strong promoters appropriate for the chosen system, and codon optimization for rat-to-human (or other host) expression may improve protein yields.

What are the critical factors affecting the yield and functionality of recombinant rat Sstr3?

Several factors significantly impact the successful production of functional recombinant rat Sstr3. First, the design of expression constructs should include proper signal peptides to facilitate membrane insertion. Temperature modulation during expression (typically lowering to 30-32°C) can improve folding efficiency of this complex membrane protein. The choice of detergents for solubilization is critical - mild detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (Lauryl Maltose Neopentyl Glycol) better preserve GPCR structure compared to harsher alternatives. Additionally, the inclusion of cholesterol or cholesterol analogs during purification helps maintain receptor stability, as these lipids interact with transmembrane domains. For functional studies, reconstitution into appropriate lipid environments that mimic neuronal membranes can significantly enhance receptor activity compared to detergent-solubilized preparations.

How can researchers verify the structural integrity of recombinant rat Sstr3 after purification?

Verifying the structural integrity of purified recombinant rat Sstr3 requires multiple complementary approaches. Western blot analysis using specific antibodies against Sstr3 can confirm the expected molecular weight (approximately 46 kDa) , though variations may occur depending on post-translational modifications. Size-exclusion chromatography profiles should demonstrate monodisperse peaks, indicating properly folded protein rather than aggregates. Circular dichroism spectroscopy can verify the alpha-helical content expected from a seven-transmembrane domain protein. For higher resolution structural assessment, limited proteolysis patterns of properly folded GPCRs differ significantly from misfolded versions. Most importantly, functional verification through ligand binding assays using radiolabeled somatostatin peptides provides the ultimate confirmation of correct folding. Thermostability assays measuring protein denaturation curves can also indicate whether the recombinant protein exhibits stability properties consistent with native receptors.

What are the validated antibodies and detection methods for studying rat Sstr3 in various experimental contexts?

For reliable detection of rat Sstr3, researchers have several validated antibody options with demonstrated specificity. Monoclonal antibodies, such as clone 7H8E5 (ab201952), have shown consistent performance in Western blot applications at 1/500 dilution and flow cytometry at 1/200 dilution . When selecting antibodies, consider the epitope location - antibodies targeting the N-terminal region (amino acids 1-50) of rat Sstr3 have demonstrated good specificity . For immunohistochemistry applications, optimized antigen retrieval methods (typically citrate buffer pH 6.0) improve detection sensitivity. Beyond antibody-based methods, radioligand binding assays using [125I]-labeled somatostatin analogs provide quantitative assessment of functional receptors. For live-cell studies, fluorescent ligand derivatives or receptor constructs tagged with fluorescent proteins offer dynamic visualization options while maintaining receptor functionality.

How can researchers determine the expression levels of Sstr3 in different rat tissues or cell lines?

Quantitative assessment of Sstr3 expression across different rat tissues or cell lines requires a multi-method approach for comprehensive characterization. At the mRNA level, quantitative RT-PCR with validated primer sets specific for rat Sstr3 (avoiding cross-reactivity with other receptor subtypes) provides relative expression data. Western blot analysis with calibrated standards allows protein-level semi-quantification, with expected band size at 46 kDa . For more precise quantification, ELISA methods optimized for membrane proteins can be employed. Flow cytometry offers single-cell resolution of expression levels in heterogeneous populations, as demonstrated in HeLa cells . Importantly, functional receptor density can be determined through saturation binding assays using radiolabeled ligands with Scatchard analysis. When comparing expression across different experimental conditions, include reference tissues or cell lines with established expression patterns as internal controls.

What controls should be included when verifying Sstr3 antibody specificity for immunodetection methods?

Rigorous validation of antibody specificity is essential for reliable Sstr3 detection. Positive controls should include cell lines with confirmed Sstr3 expression such as HeLa, PANC1, PC12, SK-N-SH, U937, or HepG2 cells, which have demonstrated detectable levels of the receptor . Negative controls should include tissues or cell lines lacking Sstr3 expression, or ideally, Sstr3 knockout models. Competition assays, where the immunizing peptide blocks antibody binding, provide additional specificity confirmation. For cross-reactivity assessment, especially important when studying multiple somatostatin receptor subtypes, expression systems containing individual subtypes should be tested with the antibody in parallel. When conducting immunohistochemistry, include absorption controls and secondary-only controls to identify non-specific binding. Additionally, comparing staining patterns from two antibodies recognizing different epitopes of Sstr3 provides strong validation of the observed signals.

What are the recommended experimental approaches for studying Sstr3-mediated signal transduction?

To effectively investigate Sstr3-mediated signaling, researchers should implement assays targeting key downstream pathways. Since Sstr3 couples primarily to Gi/o proteins that inhibit adenylyl cyclase , cAMP assays (either radioactive or FRET-based) represent primary readouts, measuring the receptor's ability to suppress forskolin-stimulated cAMP production. Complementary approaches include measuring pertussis toxin sensitivity to confirm Gi/o involvement. For G-protein activation assessment, [35S]GTPγS binding assays directly measure nucleotide exchange upon receptor activation. Investigating additional signaling includes examination of MAP kinase pathway activation (ERK1/2 phosphorylation), calcium flux measurements, and β-arrestin recruitment assays. For comprehensive pathway analysis, phosphoproteomic approaches following receptor stimulation can map the signaling network. These experiments should incorporate appropriate controls including selective Sstr3 antagonists and comparison with other receptor subtypes to delineate specific Sstr3-mediated responses.

How can researchers distinguish between direct Sstr3 effects and indirect effects mediated through other receptors?

Distinguishing direct Sstr3-mediated effects from indirect signaling requires careful experimental design. First, employ subtype-selective ligands that preferentially activate Sstr3 over other somatostatin receptor subtypes. Complementary approaches include using selective Sstr3 antagonists to block observed effects, confirming receptor involvement. Genetic approaches provide more definitive evidence - specifically, siRNA knockdown, CRISPR-Cas9 knockout, or selective overexpression of Sstr3. Temporal analysis of signaling events helps establish causality, as direct effects typically occur more rapidly than indirect effects. Experiments in heterologous expression systems containing only Sstr3 (without other somatostatin receptor subtypes) can confirm intrinsic signaling capabilities. For integrated systems, combined pharmacological and genetic approaches provide the strongest evidence for direct Sstr3 involvement versus compensatory or network effects through other receptors or downstream signaling crosstalk.

What computational approaches are most effective for modeling rat Sstr3 structure and ligand interactions?

Computational modeling of rat Sstr3 structure and ligand interactions benefits from the protein's classification within the well-studied GPCR superfamily. Homology modeling represents the foundation, using crystallized GPCR structures as templates, with particular value from related peptide receptors. The transmembrane domains, being the most conserved regions, can be modeled with higher confidence than the variable loop regions . Molecular dynamics simulations, particularly in explicit lipid bilayers, help refine models by accommodating the flexible nature of GPCRs. For ligand docking, induced-fit approaches that allow conformational adaptation of binding pockets yield more accurate predictions than rigid receptor models. Structure evaluation should include Ramachandran plot analysis, RMSD calculations against template structures, and validation of characteristic GPCR motifs. Advanced approaches include fragment-based methods to identify anchor points for ligand interaction and metadynamics simulations to explore conformational landscapes. These computational predictions should ultimately guide experimental validation through mutagenesis studies targeting predicted interaction residues.

Which amino acid residues in rat Sstr3 are critical for ligand binding and receptor activation?

Critical amino acid residues in rat Sstr3 can be classified into several functional categories based on structural analysis and comparison with related GPCRs. The extracellular domain, particularly ECL2 and the N-terminal region, contains residues that provide initial ligand recognition . Within the transmembrane domains, conserved residues in TM3 (including the DRY motif at positions 140-142) are essential for G-protein coupling and activation . The binding pocket formed primarily by residues in TM3, TM5, and TM6 contains hydrophobic and charged residues that interact directly with somatostatin peptides. Specific cysteine residues form disulfide bonds critical for maintaining receptor conformation, particularly between ECL1 and ECL2. Residues in ICL2 and ICL3 mediate interactions with G proteins and other signaling partners . Systematic alanine scanning mutagenesis combined with functional assays provides experimental verification of these critical residues. Researchers should consider the highly conserved nature of many key residues across species when translating findings between rat and human studies.

What techniques are available for investigating Sstr3 dimerization and protein-protein interactions?

Investigation of Sstr3 dimerization and protein-protein interactions requires techniques that can detect associations while maintaining the receptor's native membrane environment. For detecting homodimerization or heterodimerization with other receptors, resonance energy transfer approaches (FRET/BRET) using differentially tagged receptors provide evidence in living cells. Proximity ligation assays offer an alternative approach for detecting protein proximity (<40nm) in fixed cells or tissues. Biochemical methods including co-immunoprecipitation following chemical crosslinking can stabilize transient interactions for detection. For identifying novel interaction partners, mass spectrometry-based proteomics following immunoprecipitation of Sstr3 can reveal the interactome network. Mammalian two-hybrid systems adapted for membrane proteins can verify direct interactions. Super-resolution microscopy techniques like PALM or STORM can visualize receptor clustering patterns at nanoscale resolution. Functional complementation approaches, where inactive receptor fragments regain function upon association, provide evidence of physical interaction coupled with functional significance.

What experimental models best demonstrate the physiological roles of Sstr3 in the rat nervous system?

Investigating Sstr3 physiological functions in the rat nervous system requires models that preserve native neuronal circuits while allowing specific manipulation of the receptor. Genetic models, including Sstr3-knockout rats generated through CRISPR-Cas9, provide valuable systems for loss-of-function studies. For acute manipulation, stereotactic injection of viral vectors expressing shRNA against Sstr3 into specific brain regions enables localized knockdown. Complementary pharmacological approaches utilize subtype-selective Sstr3 agonists and antagonists, though these should be validated for specificity. Electrophysiological recordings in brain slices combined with Sstr3 manipulation reveal effects on neuronal excitability and synaptic transmission. Primary neuronal cultures from specific brain regions allow detailed cellular studies in a controlled environment. For behavioral assessment, tests examining learning, memory, and neuroendocrine function are particularly relevant given Sstr3 expression patterns. The combination of multiple approaches (genetic, pharmacological, electrophysiological, and behavioral) provides the most comprehensive understanding of Sstr3 function in the nervous system.

How does phosphorylation status affect Sstr3 function and trafficking?

Phosphorylation represents a critical regulatory mechanism for Sstr3 function, affecting multiple aspects of receptor biology. Upon activation, G protein-coupled receptor kinases (GRKs) phosphorylate specific serine and threonine residues primarily in the intracellular loops and C-terminal domain, initiating desensitization. These phosphorylation events promote β-arrestin recruitment, leading to receptor internalization through clathrin-coated pits. The pattern of phosphorylation (which specific residues are phosphorylated) can direct differential trafficking fates - either recycling back to the plasma membrane or lysosomal degradation. Additionally, second messenger-dependent kinases (PKA, PKC) can phosphorylate distinct sites, creating crosstalk with other signaling pathways. To study these events, researchers can employ phospho-specific antibodies, mass spectrometry-based phosphoproteomic analysis, and mutagenesis of key phosphorylation sites. Live-cell imaging of fluorescently tagged receptors combined with phosphomimetic or phosphodeficient mutations provides dynamic visualization of how phosphorylation impacts trafficking patterns.

What are the methodological approaches for studying Sstr3 in neurodegenerative disease models?

Investigation of Sstr3 in neurodegenerative disease contexts requires specialized approaches across multiple scales. Animal models of neurodegenerative diseases (including transgenic Alzheimer's, Parkinson's, or Huntington's disease rat models) can be evaluated for alterations in Sstr3 expression, localization, and function during disease progression. Quantitative receptor autoradiography in brain sections provides spatial mapping of functional receptor levels, while immunohistochemistry reveals cellular and subcellular localization changes . Combined genomic and proteomic approaches help identify disease-specific alterations in Sstr3 expression or post-translational modifications. Primary neuronal cultures derived from disease model animals allow mechanistic studies at the cellular level. For translational relevance, parallel studies in post-mortem human tissue and animal models strengthen findings. Intervention studies using Sstr3-selective compounds in disease models can evaluate therapeutic potential. Single-cell approaches including patch-clamp electrophysiology and single-cell transcriptomics help address cellular heterogeneity in disease contexts, revealing cell type-specific roles of Sstr3 in neurodegenerative processes.

How can CRISPR-Cas9 technology be optimized for studying rat Sstr3 function?

Optimizing CRISPR-Cas9 approaches for rat Sstr3 requires careful consideration of several technical aspects. For guide RNA design, target sequences should be selected within critical functional domains (ligand binding regions, G-protein coupling interfaces) while maintaining specificity to avoid off-target effects. Online tools specifically calibrated for the rat genome should be used for gRNA design and off-target prediction. Delivery methods need optimization based on the experimental system - for primary neurons, lentiviral vectors typically achieve higher efficiency than transfection, while in vivo editing may require AAV vectors with neuron-specific promoters. For precise edits (rather than knockouts), homology-directed repair templates should include rat Sstr3 sequences with sufficient homology arms (>500bp). Verification of edits requires comprehensive validation including sequencing, Western blotting , and functional assays to confirm the expected phenotype. For temporal control, inducible CRISPR systems using doxycycline-regulated promoters allow developmental stage-specific manipulation. When targeting specific neural circuits, combining CRISPR with Cre-dependent systems in region-specific transgenic rat lines enables circuit-level investigation of Sstr3 function.

What are the considerations for developing fluorescent biosensors to study Sstr3 activation in live cells?

Developing effective biosensors for monitoring Sstr3 activation requires strategic design principles that preserve receptor function while providing robust signals. FRET-based approaches typically insert fluorescent proteins into intracellular loops (preferably ICL3 due to its size) or the C-terminus, with careful selection of insertion sites to minimize functional disruption. Conformational biosensors that detect the structural rearrangements of Sstr3 upon activation should be validated against known pharmacological responses. Alternatively, downstream signaling biosensors for cAMP or G-protein activation provide indirect measures of receptor activity. When designing these tools, researchers should conduct thorough characterization including dose-response curves with agonists, antagonist blockade, and comparison to wild-type receptor pharmacology. Optimization parameters include signal-to-noise ratio, dynamic range, kinetic properties, and photostability. Advanced approaches include combining biosensors with optogenetic Sstr3 variants for precise spatiotemporal control. These biosensor systems require careful calibration in each cellular context due to potential differences in expression levels, downstream signaling components, and cellular architecture affecting the observed signals.

How can single-molecule techniques advance our understanding of Sstr3 dynamics in the membrane?

Single-molecule approaches offer unprecedented insights into the dynamics and organization of Sstr3 in cellular membranes. Single-particle tracking using quantum dots or organic dyes conjugated to antibodies against extracellular epitopes can reveal the diffusion characteristics, confinement zones, and mobility states of individual receptors. These measurements can identify differences between active and inactive receptor states or changes in lateral mobility following ligand binding. Single-molecule FRET (smFRET) provides conformational information about individual receptors, revealing the distribution of conformational states rather than ensemble averages. Techniques such as photoactivated localization microscopy (PALM) can map the nanoscale organization of Sstr3, identifying clustering patterns and interactions with membrane microdomains. For studying dynamics with high temporal resolution, fluorescence correlation spectroscopy (FCS) measures diffusion times and molecular brightness, potentially revealing oligomerization states. These approaches should be performed in physiologically relevant membrane environments, ideally in native neuronal membranes rather than simplified model systems, to capture authentic receptor behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.