Recombinant Rat Somatostatin receptor type 4 (Sstr4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sstr4; Somatostatin receptor type 4; SS-4-R; SS4-R; SS4R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-384
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sstr4
Target Protein Sequence
MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVG NALVIFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLS VDGLNMFTSVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVF ADTRPARGGEAVACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALR AGWQQRRRSEKKITRLVLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANS CANPILYGFLSDNFRRSFQRVLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPL PCQQEPMQAEPACKRVPFTKTTTF
Uniprot No.

Target Background

Function
Somatostatin receptor type 4 (Sstr4) is a receptor for somatostatin-14. The activity of this receptor is mediated by G proteins, which inhibits adenylyl cyclase. Sstr4 is functionally coupled not only to inhibition of adenylate cyclase but also to activation of both arachidonate release and mitogen-activated protein (MAP) kinase cascade.
Gene References Into Functions
  1. All SSTR1-5 proteins were observed at embryonal day 10 and increased with time in major structures, but the localization varied between the different subtypes. SSTR3-4 was co-localized with insulin and pancreatic polypeptide. PMID: 25926390
  2. sstr4 activation modulates G-protein coupled inward rectifying potassium channels and voltage stimulated calcium signals in dorsal root ganglion neurons. These mechanisms are thought to contribute to the analgesic properties of sstr4 agonists. PMID: 24769416
  3. Activity-regulated somatostatin expression reduces dendritic spine density and lowers excitatory synaptic transmission via postsynaptic somatostatin receptor 4. PMID: 23233668
  4. Somatostatin stimulates the migration of hepatic oval cells within injured liver through SSTR4. This action appears to be mediated by the PI3K pathway. PMID: 22098068
  5. Somatostatin receptor subtype 4 is expressed specifically in retinal ganglion cells. Action potentials are reduced during inhibition. PMID: 20573967
  6. There is a positive role for SST in the migration of HOCs, and this effect is mediated through SSTR4. PMID: 16534498

Show More

Hide All

Database Links

KEGG: rno:25555

STRING: 10116.ENSRNOP00000066231

UniGene: Rn.9936

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Brain, lung, heart and islets. Moderate levels in the hippocampus, cortex and olfactory bulb.

Q&A

What are the optimal storage and reconstitution conditions for maintaining Sstr4 protein stability?

For optimal storage of recombinant Sstr4 protein:

  • Store lyophilized protein at -20°C to -80°C immediately upon receipt

  • Avoid repeated freeze-thaw cycles by preparing working aliquots

  • Working aliquots can be stored at 4°C for up to one week

Reconstitution protocol:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The reconstituted protein should be stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain optimal stability . This buffer composition has been empirically determined to preserve the native conformation and functionality of the receptor protein.

How should researchers validate the functionality of recombinant Sstr4 prior to experimental use?

A comprehensive validation approach should include:

  • Protein purity assessment:

    • SDS-PAGE analysis (should show >90% purity)

    • Western blot with anti-His tag and anti-Sstr4 antibodies

  • Binding affinity verification:

    • Radioligand binding assays using [125I]-labeled somatostatin-14

    • Competition binding with known Sstr4-selective ligands

  • Functional assays:

    • G protein activation assays (measuring inhibition of adenylate cyclase)

    • Arachidonic acid mobilization assays

    • Electrophysiological measurements in expression systems

The protein should demonstrate specific binding to somatostatin with expected binding affinity (Kd values). Additionally, it should maintain its characteristic ability to inhibit adenylate cyclase and mobilize arachidonic acid when activated by an agonist . For electrophysiological validation, the receptor should mediate long-lasting signaling that decays slowly after agonist washout, distinguishing it from other somatostatin receptor subtypes like SSTR3 .

What is the significance of the C-terminal motif in rat Sstr4 for receptor internalization, and how can researchers exploit this feature?

The C-terminal portion of rat Sstr4 contains a crucial 20-amino acid motif that prevents rapid agonist-dependent receptor internalization. This internalization-blocking property distinguishes Sstr4 from other somatostatin receptor subtypes and contributes to its long-lasting signaling properties.

Key research findings:

  • Molecular dissection of this motif revealed that mutation of a single residue (threonine 331 to alanine, T331A) releases this internalization block

  • Confocal microscopy confirms that wildtype Sstr4 remains at the cell surface after agonist exposure, while the T331A mutant internalizes

  • Despite internalization, the T331A mutant fails to recycle to the cell surface, suggesting it lacks sequence elements for proper intracellular sorting

  • Neither wildtype nor T331A exhibits functional desensitization in adenylate cyclase inhibition assays

  • Neither receptor shows agonist-induced phosphorylation

Research applications:
Researchers can exploit this unique feature by:

  • Using Sstr4 as a model system for studying receptor trafficking independent of desensitization

  • Creating chimeric receptors containing the Sstr4 C-terminal motif to extend signaling duration of other GPCRs

  • Developing therapeutic approaches targeting sustained receptor signaling without desensitization

  • Comparing the signaling profiles of wildtype versus T331A mutant to isolate internalization-dependent and independent pathways

This distinctive property makes Sstr4 particularly valuable for studies requiring prolonged signaling without receptor desensitization .

How do molecular dynamics simulations inform structure-based drug design targeting Sstr4?

Molecular dynamics (MD) simulations provide critical insights for structure-based drug design targeting Sstr4 by elucidating binding modes, identifying key interaction sites, and guiding the development of selective ligands.

Key methodological approaches:

  • MD simulations of ligand-receptor complexes in microsecond ranges

  • Embedding of Sstr4 in POPC (1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine) bilayers to mimic physiological membrane environment

  • Analysis of binding pocket stability and ligand interactions throughout simulation

  • Comparison with experimental mutation data to validate computational models

Critical findings from recent simulations:

  • The binding mode of peptide ligands (e.g., Fj1) is stabilized primarily through D-Trp4 and Lys5 interactions

  • D-Trp4 resides in a hydrophobic pocket formed by Leu123, Met130, Phe131, Ile181, Leu200, and Phe275

  • Lys5 forms a critical salt bridge with Asp126 and hydrogen bonds with Ser300

  • These interaction patterns mirror those observed in cryo-EM structures of SSTR4 bound to SST-14

This computational approach, combined with experimental validation through alanine scanning and functional assays, has successfully guided the development of venom-inspired SSTR4-selective agonists with potential as pain therapeutics. The identification of the minimal bioactive core (Cys3-D-Trp4-Lys5-Phe6-Gly7-Cys8) provides a scaffold for further drug development .

What are the unique signaling pathways coupled to Sstr4 compared to other somatostatin receptor subtypes?

Sstr4 exhibits distinctive signaling characteristics that differentiate it from other somatostatin receptor subtypes. These unique signaling properties can be leveraged for subtype-selective therapeutic targeting.

Comparative signaling profile:

Signaling PathwaySstr4 ResponseComparison to Other SSTR Subtypes
Adenylate cyclase inhibitionPotent inhibition without desensitizationOther subtypes (especially SSTR2, SSTR3) show desensitization
Arachidonic acid mobilizationSignificant release upon activationLess prominent in SSTR1 and SSTR2
K+ channel modulationLong-lasting, slowly decaying currentSSTR3 mediates rapidly desensitizing currents
Receptor internalizationResistant to agonist-induced internalizationSSTR2, SSTR3, SSTR5 rapidly internalize after agonist exposure
PhosphorylationMinimal agonist-induced phosphorylationSSTR2, SSTR3, SSTR5 show robust phosphorylation

Sstr4 activation leads to arachidonic acid release as part of its signaling cascade . This may contribute to downstream effects such as the modulation of M-currents and BK Ca channel activity, potentially through the generation of arachidonic acid metabolites like leukotriene C4 (LTC4).

Experimental approaches to study Sstr4-specific signaling:

  • Use selective agonists with defined receptor subtype specificity

  • Employ knockout/knockdown systems to isolate subtype-specific effects

  • Utilize chimeric receptors to identify domains responsible for pathway coupling

  • Compare signaling dynamics temporally, as Sstr4's sustained signaling is a distinguishing feature

Understanding these unique signaling properties is crucial for developing therapeutic strategies targeting specific physiological processes while minimizing off-target effects .

What expression systems are most suitable for recombinant rat Sstr4 production, and what are their comparative advantages?

Different expression systems offer distinct advantages for recombinant rat Sstr4 production, depending on research objectives:

Bacterial expression (E. coli):

  • Advantages: High yield, cost-effective, simple scaling

  • Limitations: Lack of post-translational modifications, potential inclusion body formation

  • Best for: Producing large quantities of protein for structural studies, antibody production

  • Method optimization: Use specialized strains (e.g., BL21(DE3)pLysS), optimize codons, and employ solubilization strategies

Mammalian cell expression (HEK293, CHO):

  • Advantages: Proper folding, post-translational modifications, trafficking

  • Limitations: Lower yield, higher cost, more complex protocols

  • Best for: Functional studies, trafficking research, drug screening

  • Method optimization: Stable cell line generation using lentiviral vectors or transposons

Insect cell expression (Sf9, High Five):

  • Advantages: Higher yield than mammalian systems, most post-translational modifications

  • Limitations: Some differences in glycosylation patterns

  • Best for: Balance between yield and proper folding/modification

  • Method optimization: Optimize MOI and harvest timing

Xenopus oocytes:

  • Advantages: Rapid expression, suitable for electrophysiological studies

  • Limitations: Not practical for large-scale protein production

  • Best for: Electrophysiological characterization of channel coupling

  • Method optimization: Microinjection of cRNA, co-expression with G-protein-gated inwardly rectifying potassium channels

For studies focused on receptor trafficking and internalization, mammalian expression systems are essential to preserve the native cellular machinery. For electrophysiological studies examining Sstr4's characteristic long-lasting signaling properties, Xenopus oocyte expression combined with potassium channel co-expression provides an excellent system .

What are the most effective strategies for designing selective Sstr4 agonists based on structure-activity relationships?

Designing selective Sstr4 agonists requires systematic structure-activity relationship (SAR) studies informed by receptor structure and binding interactions. Recent advances highlight several effective strategies:

1. Alanine scanning approach:
Recent studies revealed that selective Sstr4 agonists can be developed by systematically modifying key residues:

2. Stereochemistry modifications:

  • Changing D-Trp to L-Trp has minimal effect on Sstr4 potency but increases Sstr1 potency

  • Substituting L-Phe6 with D-Phe decreases Sstr4 potency by 42-fold

  • These findings highlight the importance of stereochemistry in determining receptor subtype selectivity

3. Minimal bioactive core approach:

  • The core sequence Cys3-D-Trp4-Lys5-Phe6-Gly7-Cys8 maintains significant activity

  • Selective trimming of N-terminal or C-terminal residues provides insights for optimizing peptide length

  • Deletion of only the C-terminus results in an analog that maintains nearly equivalent potency at Sstr4

4. Venom-inspired peptide design:

  • Natural peptides from venoms can serve as templates for selective Sstr4 agonists

  • Cyclization strategies improve stability and constrain peptides in bioactive conformations

  • Integration of non-natural amino acids can enhance selectivity profiles

These structure-based design strategies, combined with functional assays measuring G-protein dissociation, provide a systematic pathway for developing selective Sstr4 agonists as potential therapeutics for persistent pain and other conditions .

What experimental approaches can effectively distinguish between Sstr4-mediated effects and those of other somatostatin receptor subtypes?

Distinguishing Sstr4-mediated effects from those of other somatostatin receptor subtypes is crucial for accurate interpretation of experimental results. Several complementary approaches can be employed:

1. Pharmacological approaches:

  • Use of subtype-selective agonists:

    • L-803,087 and J-2156 for Sstr4

    • Octreotide for Sstr2, Sstr3, and Sstr5 (but not Sstr4)

  • Application of selective antagonists:

    • NVP-ACQ090 for Sstr4

    • CYN 154806 for Sstr2

2. Genetic approaches:

  • CRISPR-Cas9 gene editing to knockout specific receptor subtypes

  • siRNA knockdown of specific receptor subtypes

  • Generation of cell lines or animal models with selective receptor expression

3. Distinctive signaling pattern identification:

  • Monitor signal duration: Sstr4 mediates unusually prolonged signaling

  • Measure internalization: Sstr4 shows resistance to agonist-induced internalization

  • Assess phosphorylation status: Sstr4 exhibits minimal agonist-induced phosphorylation

4. Electrophysiological fingerprinting:
When co-expressed with G-protein-gated, inwardly rectifying potassium channels:

  • Sstr4 activation produces strong, long-lasting inward potassium currents that decay slowly after agonist washout

  • Sstr3 mediates rapidly desensitizing currents

  • This distinct electrophysiological profile can be used as a functional signature

5. Binding kinetics analysis:

  • Radioligand binding studies show that the sustained signaling of Sstr4 is not attributable to slow agonist dissociation

  • Time-resolved binding experiments can differentiate receptor subtypes based on association and dissociation kinetics

These approaches, particularly when used in combination, provide robust methods for attributing observed effects specifically to Sstr4 activation versus activation of other somatostatin receptor subtypes.

How can the long-lasting signaling properties of Sstr4 be leveraged for therapeutic development?

The distinctive long-lasting signaling properties of Sstr4 offer unique advantages for therapeutic development, particularly for conditions requiring sustained receptor activation without desensitization.

Mechanism of prolonged signaling:
Sstr4's unusual signaling persistence derives from several molecular features:

  • Resistance to agonist-induced internalization due to a 20-amino acid motif in the C-terminal region

  • Lack of functional desensitization when assayed for adenylate cyclase inhibition

  • Minimal agonist-induced receptor phosphorylation

  • Sustained coupling to downstream effectors including potassium channels

Therapeutic applications leveraging these properties:

  • Pain management:

    • Persistent activation of Sstr4 can provide sustained analgesia

    • Venom-inspired Sstr4-selective agonists show promise as novel pain therapeutics

    • Targeting Sstr4 may avoid the tolerance development seen with opioid receptors

  • Neurological disorders:

    • Sustained modulation of neuronal excitability through K+ channel coupling

    • Potential applications in epilepsy, where tonic inhibition is beneficial

    • The lack of desensitization provides an advantage over rapidly desensitizing targets

  • Inflammatory conditions:

    • Prolonged anti-inflammatory effects through sustained inhibition of pro-inflammatory mediator release

    • Potential applications in chronic inflammatory conditions requiring sustained therapy

  • Drug delivery strategies:

    • Development of long-acting agonists that complement the receptor's inherent resistance to desensitization

    • Controlled-release formulations designed to maintain steady-state activation

    • Biased agonists that preferentially activate specific signaling pathways

Clinical relevance is supported by the observation that "SSTR4 mediates long-lasting signaling, a property which may be relevant for clinical therapy" . The development of venom-inspired Sstr4-selective peptides represents a promising avenue for translating these unique signaling properties into therapeutics, particularly for persistent pain conditions .

What role does Sstr4 play in arachidonic acid mobilization, and how can this pathway be studied?

Sstr4 activation leads to arachidonic acid mobilization, a signaling pathway with important physiological consequences. Understanding this mechanism requires specialized experimental approaches.

Signaling pathway overview:
Activation of rat Sstr4 triggers arachidonic acid release through a complex signaling cascade that may involve:

  • Phospholipase A2 (PLA2) activation

  • Subsequent metabolism by cyclooxygenases, lipoxygenases, or cytochrome P450 enzymes

  • Generation of bioactive lipid mediators including leukotrienes (particularly LTC4)

Methodological approaches for studying this pathway:

  • Direct measurement of arachidonic acid release:

    • Radiolabeling with [³H]-arachidonic acid followed by stimulation with Sstr4-selective agonists

    • Liquid chromatography-mass spectrometry (LC-MS) to quantify released arachidonic acid and metabolites

    • Comparison between wild-type and T331A mutant to determine if internalization affects this pathway

  • Downstream mediator identification:

    • Lipidomic profiling of eicosanoids and related metabolites

    • Selective inhibitors of different arachidonic acid metabolizing enzymes:

      • Cyclooxygenase inhibitors (e.g., indomethacin)

      • Lipoxygenase inhibitors (e.g., zileuton for 5-LOX)

      • Cytochrome P450 inhibitors (e.g., ketoconazole)

    • Genetic approaches (knockdown/knockout) of key enzymes in the pathway

  • Functional consequence assessment:

    • Electrophysiological recording of M-currents and BK Ca channel activity

    • Patch-clamp studies in native tissues and receptor-expressing systems

    • Calcium imaging to detect secondary effects of arachidonic acid metabolites

Research findings and applications:

  • Somatostatin-stimulated increases in neuronal M-currents may be mediated through arachidonic acid metabolites like LTC4

  • BK Ca channel activity in pituitary tumor cells can be stimulated by somatostatin, possibly through Sstr2 activation, via leukotriene production

  • The concentration of somatostatin required for arachidonic acid mobilization through Sstr5 is much higher than for adenylate cyclase inhibition

This pathway represents an important mechanism by which Sstr4 activation can modulate neuronal excitability and potentially influence inflammatory processes, making it a valuable target for both basic research and therapeutic development.

What are common challenges in achieving functional expression of recombinant Sstr4, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant Sstr4. Here are systematic approaches to address these common issues:

1. Low expression levels:

  • Problem: G-protein coupled receptors like Sstr4 often express poorly in heterologous systems

  • Solutions:

    • Optimize codon usage for the expression host

    • Use stronger promoters (CMV for mammalian cells, T7 for bacterial systems)

    • Include chaperon proteins to aid proper folding

    • Add N-terminal signal sequences to improve membrane targeting

    • Consider fusion partners that enhance expression (e.g., SUMO, MBP)

2. Protein misfolding and aggregation:

  • Problem: Transmembrane proteins frequently misfold, particularly in bacterial systems

  • Solutions:

    • Express in eukaryotic systems for complex membrane proteins

    • Reduce expression temperature (e.g., 16-18°C for E. coli)

    • Include membrane-mimetic environments (detergents, nanodiscs)

    • Optimize solubilization buffers with appropriate detergents

    • Screen multiple detergent types for extraction efficiency

3. Non-functional protein:

  • Problem: Expressed protein lacks expected binding or signaling properties

  • Solutions:

    • Verify protein sequence for mutations

    • Ensure proper post-translational modifications in chosen expression system

    • Test multiple tagging strategies (N-terminal vs. C-terminal tags)

    • Consider the impact of tags on receptor functionality

    • Validate with multiple functional assays (binding, signaling, trafficking)

4. Receptor trafficking issues:

  • Problem: Receptor fails to reach plasma membrane in mammalian systems

  • Solutions:

    • Co-express with chaperones or trafficking proteins

    • Verify signal sequence functionality

    • Create chimeric receptors with well-trafficking domains

    • Use fluorescent tags to monitor subcellular localization

    • Consider the T331A mutation which alters trafficking properties

5. Stability during purification and storage:

  • Problem: Receptor loses activity during purification or storage

  • Solutions:

    • Include receptor-specific ligands during purification to stabilize structure

    • Optimize buffer conditions (pH, salt concentration, additives)

    • Add glycerol (5-50%) and trehalose (6%) to storage buffers

    • Avoid repeated freeze-thaw cycles by preparing working aliquots

    • Store at -80°C for long-term preservation

Applying these strategies systematically can significantly improve the expression, functionality, and stability of recombinant Sstr4 for research applications.

How can researchers validate the specificity of observed effects in Sstr4 studies?

Ensuring that observed effects are specifically mediated by Sstr4 rather than other mechanisms is crucial for research validity. A comprehensive validation approach includes:

1. Pharmacological validation:

  • Positive controls: Use multiple Sstr4-selective agonists (e.g., L-803,087, J-2156) to confirm effect reproducibility

  • Negative controls: Demonstrate lack of response with agonists selective for other SSTR subtypes

  • Competitive antagonism: Show dose-dependent inhibition with Sstr4-selective antagonists

  • Dose-response relationships: Establish EC50/IC50 values consistent with known Sstr4 pharmacology

2. Genetic validation:

  • Knockdown/knockout approaches: Demonstrate loss of effect in Sstr4-depleted systems

  • Rescue experiments: Restore response by reintroducing wildtype Sstr4

  • Mutational analysis: Show correlation between binding affinity and functional response with structure-guided mutations

  • Cross-species validation: Confirm similar effects with Sstr4 from different species, accounting for known species differences

3. Signaling pathway validation:

  • Pathway inhibitors: Use specific inhibitors of known Sstr4 downstream pathways

  • Signal transduction analysis: Monitor multiple readouts (cAMP inhibition, arachidonic acid release, K+ currents)

  • Temporal characteristics: Verify the characteristic long-lasting signaling pattern of Sstr4

  • G-protein coupling: Confirm involvement of appropriate G-proteins using inhibitors or dominant negative constructs

4. Technical controls:

  • Vehicle controls: Ensure observed effects aren't due to solvents or carriers

  • Transfection/expression controls: Verify similar expression levels when comparing constructs

  • Positive control receptors: Include well-characterized GPCRs as system validation

  • Blinding: Conduct critical experiments under blinded conditions

5. Independent method confirmation:

  • Complementary assay technologies: Confirm findings using different methodological approaches

  • In vitro and in vivo correlation: Demonstrate consistent results across different experimental systems

  • Cross-laboratory validation: Reproduce key findings in independent laboratory settings

By implementing this multi-faceted validation approach, researchers can establish with high confidence that their observed effects are specifically attributable to Sstr4 activity rather than experimental artifacts or actions at other receptor subtypes.

What emerging technologies might advance our understanding of Sstr4 structure and function?

Several cutting-edge technologies are poised to significantly advance Sstr4 research:

1. Advanced structural biology approaches:

  • Cryo-electron microscopy (cryo-EM): Enables visualization of Sstr4 in different conformational states with near-atomic resolution

  • Single-particle analysis: Captures conformational heterogeneity and dynamic states

  • Microcrystal electron diffraction (MicroED): Allows structural determination from nanocrystals

  • Integrative structural biology: Combines multiple techniques (cryo-EM, NMR, X-ray) for comprehensive structural insights

2. Computational methods:

  • Enhanced sampling molecular dynamics: Explores conformational landscape more efficiently

  • Artificial intelligence for structure prediction: Tools like AlphaFold2 and RoseTTAFold can predict structures with unprecedented accuracy

  • Machine learning for drug discovery: Identifies novel Sstr4 ligands with desired properties

  • Quantum mechanics/molecular mechanics (QM/MM): Provides insights into electronic properties at binding sites

3. Advanced imaging technologies:

  • Super-resolution microscopy: Visualizes receptor clustering and organization below diffraction limit

  • Single-molecule tracking: Follows individual receptor molecules in living cells

  • Biosensor development: FRET/BRET-based sensors to monitor receptor conformation and signaling in real-time

  • Expansion microscopy: Physical enlargement of specimens for enhanced resolution

4. Genetic engineering approaches:

  • CRISPR-Cas9 precise genome editing: Creates specific mutations to study structure-function relationships

  • Conditional knockout models: Enables temporal and spatial control of Sstr4 expression

  • Base editing and prime editing: Introduces specific mutations without double-strand breaks

  • Chemogenetic tools: Engineered Sstr4 variants responsive to designer ligands

5. Advanced proteomics and interactomics:

  • Proximity labeling: Identifies protein interaction networks in native cellular contexts

  • Cross-linking mass spectrometry: Maps protein interfaces and structural organization

  • Thermal proteome profiling: Evaluates drug-target engagement and off-target effects

  • Single-cell proteomics: Reveals cell-to-cell variability in Sstr4 signaling

These technologies will likely resolve key questions regarding Sstr4's unique signaling properties, including the molecular basis for its resistance to internalization, its sustained signaling capacity, and its distinctive arachidonic acid mobilization pathway . Such advances will accelerate the development of Sstr4-targeted therapeutics, particularly for pain management applications, where venom-inspired peptides are showing promise as novel analgesics .

What are the most promising therapeutic applications for Sstr4-selective compounds based on current research?

Based on current research findings, several therapeutic applications for Sstr4-selective compounds show particular promise:

1. Chronic pain management:

  • Venom-inspired Sstr4 agonists represent a novel avenue for addressing persistent pain

  • Unlike opioids, Sstr4 agonists may provide analgesic effects without significant tolerance or dependence

  • The long-lasting signaling properties of Sstr4 are particularly advantageous for chronic pain conditions

  • Recent research demonstrates progress in designing Sstr4-selective peptides with enhanced potency

2. Neuroinflammatory disorders:

  • Sstr4 activation modulates neuroinflammatory processes

  • Potential applications in multiple sclerosis, Alzheimer's disease, and Parkinson's disease

  • Selective Sstr4 agonists may reduce neuroinflammation while avoiding the broad immunosuppressive effects of non-selective agents

3. Epilepsy and seizure disorders:

  • The ability of Sstr4 to produce sustained modulation of neuronal excitability through K+ channel coupling makes it a promising target

  • The long-lasting signaling without desensitization provides an advantage over rapidly desensitizing targets

  • Sstr4 agonists may offer neuroprotective benefits in addition to seizure control

4. Metabolic disorders:

  • Emerging evidence suggests Sstr4 involvement in glucose homeostasis and insulin sensitivity

  • Selective targeting may provide metabolic benefits without the growth hormone suppression seen with non-selective somatostatin analogs

  • Potential applications in diabetes and obesity management

5. Cancer therapeutics:

  • Sstr4 expression in certain tumors provides opportunities for targeted therapies

  • Potential applications include both direct antiproliferative effects and targeted drug delivery

  • The resistance to internalization may be advantageous for maintaining drug exposure

The unique pharmacological profile of Sstr4—particularly its resistance to desensitization and internalization—creates opportunities for developing therapeutics with sustained efficacy for chronic conditions . The recent development of venom-inspired peptides with enhanced selectivity for Sstr4 represents a significant advancement toward realizing these therapeutic applications, especially in the field of pain management where new non-addictive analgesics are urgently needed .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.