Recombinant Rat Somatostatin receptor type 5 (Sstr5)

Shipped with Ice Packs
In Stock

Description

Introduction to Somatostatin Receptor Type 5 (Sstr5)

Somatostatin receptor type 5 (Sstr5) belongs to the family of G protein-coupled receptors that bind somatostatin, a peptide hormone initially isolated from hypothalamic tissue. Somatostatin acts through five receptor subtypes (SSTRs 1-5), each with distinct tissue distribution and functional roles. Among these subtypes, Sstr5 has emerged as a significant therapeutic target for various conditions, including neuroendocrine tumors, pituitary disorders, and metabolic abnormalities .

In rats, Sstr5 has been extensively studied as a model system for understanding the broader implications of somatostatin signaling in mammalian physiology. Recombinant rat Sstr5 provides researchers with valuable tools to investigate receptor-ligand interactions, signaling pathways, and potential therapeutic applications. The study of recombinant rat Sstr5 has contributed significantly to our understanding of somatostatin receptor biology and has implications for human health and disease management.

Molecular Structure and Characteristics of Rat Sstr5

Rat Somatostatin receptor type 5 is encoded by the Sstr5 gene, which translates into a protein that functions as a receptor for somatostatin-28. The rat Sstr5 protein consists of a seven-transmembrane domain structure characteristic of G protein-coupled receptors. The activity of this receptor is mediated by G proteins that inhibit adenylyl cyclase, leading to various downstream signaling effects .

Recent structural studies using cryo-electron microscopy have provided detailed insights into the structural basis for activation of somatostatin receptor 5. These structures reveal that binding of peptide agonists causes rearrangement of a "hydrophobic lock" consisting of residues from transmembrane helices TM3 and TM6. This rearrangement triggers outward movement of TM6, enabling Gα i protein engagement and receptor activation .

Expression and Distribution of Rat Sstr5

The expression of Sstr5 in rats follows a specific developmental pattern. Studies investigating Sstr5 expression during rat embryonic development have provided valuable insights into its distribution and potential roles during different developmental stages.

For detection of Sstr5 mRNA, researchers have utilized RT-PCR techniques with specific primers. The forward primer sequence "CTGTCCTGCACAGAGACACG" and reverse primer sequence "CATTGGCGATGCTGAGC" have been employed to successfully amplify Sstr5 transcripts in rat tissues . Results are typically calculated by comparing the difference between crossing point values of the amplified sample and housekeeping genes using the formula 2-Δ (cpssts-cpTBP).

Interestingly, research has shown that there was no SSTR5 mRNA expression detected in whole rat embryos, despite the presence of SSTR5 protein observed at embryonal day 10. From day 11 to birth, SSTR5 protein presence increased over time in major structures such as skin and cartilage, while remaining relatively stable in the heart and liver .

Table 2. Expression Pattern of Sstr5 During Rat Embryonic Development

Embryonic StagemRNA ExpressionProtein ExpressionTissue Localization
Day 10Not detectedPresentVarious embryonic tissues
Days 11-birthNot detectedIncreasingSkin, cartilage
Days 11-birthNot detectedStableHeart, liver
Day 14 (Pancreas)Not detectedPresentCo-localized with glucagon and pancreatic polypeptide cells

In the developing pancreas, SSTR5 protein was found to co-localize primarily with glucagon and pancreatic polypeptide-producing cells, suggesting specific roles in regulating these hormones. This pattern differs from other somatostatin receptor subtypes, with SSTR1 co-localizing with multiple islet hormones, SSTR2 present in all islet endocrine cells except β-cells, and SSTR3-4 co-localizing with insulin and pancreatic polypeptide .

Table 3. Co-localization of Somatostatin Receptor Subtypes with Pancreatic Hormones

Receptor SubtypeInsulinGlucagonSomatostatinPancreatic Polypeptide
SSTR1YesYesYesYes
SSTR2NoYesYesYes
SSTR3YesNoNoYes
SSTR4YesNoNoYes
SSTR5NoYesNoYes

In adult rats, Sstr5 is expressed in various tissues, with notable presence in pancreatic islets where it plays a key role in regulating insulin secretion. Subcellular localization studies indicate that Sstr5 is primarily found in the cell membrane , where it can respond to circulating somatostatin and mediate its effects on cellular function.

Functional Role of Rat Sstr5

Sstr5 plays significant roles in various physiological processes, with particularly important functions in pancreatic islets and glucose homeostasis. Studies using Sstr5 knockout (Sstr5 KO) mice have provided valuable insights into these functions.

Sstr5 mediates the inhibitory effect of somatostatin on insulin secretion from pancreatic β-cells. Research has shown that mice deficient in Sstr5 displayed increased total insulin content in pancreatic islets compared to wild-type mice. Furthermore, Sstr5 KO mice exhibited decreased blood glucose and plasma insulin levels, along with increased leptin and glucagon concentrations .

Table 4. Phenotypic Differences Between Wild-Type and Sstr5 Knockout Mice

ParameterWild-Type MiceSstr5 KO MiceFunctional Implication
Pancreatic insulin contentNormalIncreasedSstr5 normally limits insulin production
Blood glucose levelsNormalDecreasedSstr5 contributes to glucose homeostasis
Plasma insulin levelsNormalDecreasedComplex role in insulin regulation
Leptin concentrationNormalIncreasedPossible role in adipose tissue function
Glucagon concentrationNormalIncreasedInvolvement in α-cell regulation
Susceptibility to high-fat diet-induced insulin resistanceHighDecreasedPotential target for metabolic disorders

The inhibitory effect of somatostatin-28 (SRIF-28) on glucose-stimulated insulin secretion was significantly reduced in islets from Sstr5 KO mice, with a 16-fold decrease in potency compared to wild-type islets. Additionally, Sstr5 KO mice showed decreased susceptibility to high-fat diet-induced insulin resistance, suggesting that Sstr5 contributes to the regulation of insulin sensitivity .

Beyond its role in metabolic regulation, Sstr5 also demonstrates interesting functional interactions with other somatostatin receptor subtypes. For example, Sstr5 can form heterodimers with Sstr2, which increases the cell growth inhibition activity of Sstr2 . This suggests that Sstr5 may have broader roles in regulating cell proliferation and potentially in tumor suppression.

Recombinant Production and Research Tools

Recombinant rat Sstr5 has become an invaluable tool for research into somatostatin signaling and receptor biology. Several commercial products and research tools are available to facilitate these investigations.

The Rat Somatostatin R5/SSTR5 (NP_037014) VersaClone cDNA contains the complete open reading frame (ORF) for Somatostatin R5/SSTR5, along with a Kozak consensus sequence for optimal translation initiation. This recombinant DNA construct is designed with convenient multiple cloning sites that facilitate easy transfer of the gene cassette into desired expression vectors. The sequence is verified, and the entire plasmid DNA and translated sequences are provided, ensuring reliability for research applications .

Research Applications and Findings

Research using recombinant rat Sstr5 has yielded significant insights into receptor activation mechanisms, ligand selectivity, and potential therapeutic applications.

Recent structural studies have revealed distinct binding modes and conformational changes induced by different cyclic peptide agonists, namely cortistatin-17 (CST17) and octreotide. These structures show how extracellular loops differently recognize these ligands, and how a "hydrophobic lock" mediates ligand-specific interactions and receptor activation. The insights gained from these studies provide valuable guidance for structure-based drug development targeting Sstr5 for therapeutic purposes .

Table 6. Comparison of Ligand Binding Characteristics for Sstr5

LigandBinding ModeKey InteractionsConformational ChangesFunctional Outcome
Cortistatin-17 (CST17)Disulfide-stabilized β hairpin structureExtensive polar and hydrophobic interactionsRearrangement of hydrophobic lock, outward movement of TM6Full receptor activation
OctreotideUpright binding in orthosteric pocketConserved F DWKT motif forms hydrophobic interactionsSimilar to CST17 but with distinct ECL interactionsActivation with different potency/efficacy
Somatostatin-28Similar to natural ligandMultiple contact pointsStandard activation mechanismPhysiological inhibition of cellular processes

Functional studies using Sstr5 knockout models have demonstrated the receptor's importance in glucose homeostasis and insulin regulation. These findings suggest potential beneficial roles for Sstr5 antagonists in alleviating metabolic abnormalities associated with obesity and insulin resistance . Given the increasing prevalence of metabolic disorders worldwide, this research direction holds significant clinical relevance.

Developmental studies have mapped the expression patterns of Sstr5 throughout rat embryogenesis, providing insights into its potential roles in tissue development and differentiation. The distinct co-localization patterns with different pancreatic hormones suggest specific regulatory functions in endocrine cell development and function .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them during order placement, and we will fulfill your request.
Lead Time
Delivery times may vary based on the purchase method or location. Please consult your local distributors for specific delivery details.
Note: All protein shipments are accompanied by standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sstr5; Somatostatin receptor type 5; SS-5-R; SS5-R; SS5R
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-363
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MEPLSLASTPSWNASAASSGNHNWSLVGSASPMGARAVLVPVLYLLVCTVGLSGNTLVIY VVLRHAKMKTVTNVYILNLAVADVLFMLGLPFLATQNAVVSYWPFGSFLCRLVMTLDGIN QFTSIFCLMVMSVDRYLAVVHPLRSARWRRPRVAKMASAAVWVFSLLMSLPLLVFADVQE GWGTCNLSWPEPVGLWGAAFITYTSVLGFFGPLLVICLCYLLIVVKVKAAGMRVGSSRRR RSEPKVTRMVVVVVLVFVGCWLPFFIVNIVNLAFTLPEEPTSAGLYFFVVVLSYANSCAN PLLYGFLSDNFRQSFRKVLCLRRGYGMEDADAIEPRPDKSGRPQATLPTRSCEANGLMQT SRI
Uniprot No.

Target Background

Function
Somatostatin receptor type 5 (Sstr5) is a receptor for somatostatin-28. The activity of this receptor is mediated by G proteins, which inhibit adenylyl cyclase. Heterodimerization with SSTR2 enhances the cell growth inhibition activity of SSTR2.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Prominent in the pituitary and small intestine. Low levels in islets and spleen. Not detected in kidney, pancreas, cerebellum, or cortex.

Q&A

What is Somatostatin Receptor Type 5 (SSTR5) and what is its function in rat models?

SSTR5 is a G protein-coupled receptor that functions as a receptor for somatostatin-28. Its activity is mediated by G proteins, particularly Gαi, which inhibit adenylyl cyclase . In rat models, SSTR5 plays a crucial role in various physiological processes, including hormone regulation and cell growth inhibition. It forms heterodimers with SSTR2, which increases the cell growth inhibition activity of SSTR2 . SSTR5 is primarily located in the cell membrane and is involved in mediating the inhibitory effects of somatostatin on various cellular functions.

In rat embryonic development, SSTR5 protein has been observed as early as embryonal day 10, though interestingly, some studies have not detected SSTR5 mRNA expression in whole rat embryos while still detecting the protein . This suggests complex post-transcriptional regulatory mechanisms that warrant further investigation.

How does SSTR5 differ from other somatostatin receptor subtypes?

Among the five somatostatin receptor subtypes (SSTR1-5), SSTR5 shows distinct characteristics:

  • Binding Preferences: SSTR5 has higher affinity for somatostatin-28 compared to somatostatin-14, unlike other subtypes.

  • Structural Uniqueness: Recent cryo-EM structures reveal that SSTR5 has distinct conformational changes upon binding to cyclic peptide agonists like cortistatin-17 (CST17) and octreotide .

  • Developmental Expression: While other receptor subtypes like SSTR1-2 and SSTR4 show peak mRNA expression at day 14 in rat embryonic development, and SSTR3 appears at day 15, the expression profile of SSTR5 differs significantly .

  • Functional Role: SSTR5 specifically mediates the inhibition of peptide YY secretion in response to somatostatin-28 stimulation, a function not shared by other subtypes .

  • Co-localization Patterns: In pancreatic islets, SSTR5 primarily co-localizes with glucagon and pancreatic polypeptide-producing cells, while other subtypes show different cellular associations. For example, SSTR2 is present in all islet endocrine cells except β-cells, and SSTR3-4 co-localize with insulin and pancreatic polypeptide .

What is the expression profile of SSTR5 during rat embryonic development?

The developmental expression of SSTR5 in rats follows a complex pattern:

  • Protein Expression: SSTR5 protein has been detected as early as embryonal day 10 .

  • Tissue Distribution: From embryonal day 11 to birth, SSTR5 protein presence increases progressively in major structures such as skin and cartilage, while remaining relatively stable in tissues like heart and liver .

  • Pancreatic Expression: In the fetal pancreas, SSTR5 protein shows specific co-localization with glucagon and pancreatic polypeptide-producing cells .

  • mRNA Expression Peculiarity: Interestingly, some studies have reported no detectable SSTR5 mRNA expression in whole rat embryos despite observing the protein . This discrepancy suggests possible post-transcriptional regulatory mechanisms or technical limitations in mRNA detection methods.

What is the structural basis for SSTR5 activation by agonists like cortistatin-17 and octreotide?

Recent cryo-EM studies have revealed the molecular mechanisms of SSTR5 activation:

  • High-Resolution Structures: Cryo-EM structures of SSTR5-Gi complexes bound to cortistatin-17 (CST17) and octreotide have been determined at 2.7 Å and 2.9 Å resolutions, respectively .

  • Hydrophobic Lock Mechanism: Both CST17 and octreotide trigger the rearrangement of a "hydrophobic lock" consisting of residues from transmembrane helices TM3 and TM6. This rearrangement causes an outward movement of TM6, enabling Gαi protein engagement and receptor activation .

  • Distinct Binding Modes: Despite sharing a conserved F(L/D)WKT motif, CST17 and octreotide exhibit different interaction modes with SSTR5 due to variations in disulfide bond positions .

  • Key Structural Differences:

    • CST17 forms conserved polar contacts similar to those observed in somatostatin-14 binding to SSTR2

    • Octreotide binding involves a crucial intrareceptor polar network comprising Q99^2.63, T185^ECL2, and N187^45.51 that is not observed with CST17

  • Role of Extracellular Loops: The extracellular loops of SSTR5 respond differently to CST17 and octreotide, contributing to ligand selectivity. Mutations like N187^45.51T or T185^ECL2W in SSTR5 (which mimic SSTR2's ECL2 residues) significantly enhance octreotide's efficacy in activating SSTR5 .

How do SSTR5 activation mechanisms differ from classic Class A GPCR activation paradigms?

SSTR5 shows both conserved and distinctive features in its activation mechanism compared to other Class A GPCRs:

  • Conserved Features: Like other class A GPCRs, activated SSTR5 exhibits:

    • Outward movement of the cytoplasmic tail of TM6

    • Inward movement of TM7

  • Distinctive Features: SSTR5 shows subtle deviations from established Class A GPCR activation mechanisms:

    • Unique conformational changes in the "hydrophobic lock" region

    • Specific involvement of extracellular loops in ligand recognition

    • Distinct patterns of stabilizing interactions during activation

  • Ligand-Specific Activation: Different agonists (CST17 vs. octreotide) induce subtle conformational differences (RMSD values of 1.43 Å for the receptor and 1.50 Å across entire complexes), highlighting the plasticity in SSTR5 activation mechanisms .

What are the molecular determinants of agonist selectivity between SSTR5 and other somatostatin receptor subtypes?

Several key molecular features determine agonist selectivity for SSTR5:

  • Extracellular Loop Configuration: The extracellular loops of SSTR5 play a crucial role in specific recognition of different agonists. For example, ECL2 is particularly important for octreotide selectivity .

  • Polar Interaction Networks: A polar network formed by Q99^2.63, T185^ECL2, and N187^45.51 appears to influence octreotide binding and may actually hinder activation of SSTR5 by octreotide relative to other receptor subtypes .

  • Key Residue Differences: Mutations that transform SSTR5 residues to match those in SSTR2 (such as N187^45.51T or T185^ECL2W) enhance octreotide efficacy, highlighting the importance of these residues in determining subtype selectivity .

  • Ligand Structure Variations: The positioning of disulfide bonds within peptide ligands creates structural variations that lead to different interaction modes with the receptor subtypes. This is evident in the distinct binding conformations of CST17 and octreotide within SSTR5 .

What are the optimal techniques for measuring SSTR5 expression in rat tissue samples?

Several complementary methods are recommended for comprehensive assessment of SSTR5 expression:

  • RT-PCR for mRNA Detection:

    • Calculate results by comparing the difference between crossing point (cp) values of the amplified sample and housekeeping mRNA using the formula 2^-Δ(cpSSTR5-cpTBP) .

  • ELISA for Protein Quantification:

    • Commercially available Rat SSTR5 ELISA kits offer:

      • Detection range: 7.8-500 pg/mL

      • Sensitivity: 3.94 pg/mL

      • Appropriate for serum, plasma, tissue homogenates, and cell culture supernatants

  • Immunohistochemistry for Localization:

    • Particularly useful for determining co-localization with other cellular markers

    • Has successfully identified SSTR5 in embryonic tissues as early as day 10

  • Single-Point Mutation Analysis:

    • Can be used to assess functional significance of specific residues

    • Example mutations like Q99^2.63A and N187^45.51A have demonstrated varying effects on receptor activation

How should researchers design experiments to investigate SSTR5-mediated signaling pathways?

A comprehensive experimental approach should include:

  • Receptor Activation Studies:

    • Measure inhibition of adenylyl cyclase activity as SSTR5 activation inhibits this enzyme through Gαi proteins

    • Compare responses to different agonists (somatostatin-28, CST17, octreotide) to assess ligand-specific effects

  • Protein-Protein Interaction Studies:

    • Investigate SSTR5 heterodimerization with SSTR2, which increases cell growth inhibition activity

    • Employ co-immunoprecipitation or proximity ligation assays to confirm interactions

  • Mutagenesis Approaches:

    • Target key residues identified in structural studies:

      • Hydrophobic lock residues in TM3 and TM6

      • Extracellular loop residues (particularly N187^45.51 and T185^ECL2)

      • Residues involved in G-protein coupling

  • Developmental Expression Studies:

    • Combine mRNA and protein detection methods due to potential discrepancies

    • Include multiple developmental timepoints (examples from published work include embryonal days 10, 11, 12, 14, 15, 17, 19, 21, and birth)

  • Controls and Validation:

    • Include appropriate pharmacological controls (antagonists like pasireotide)

    • Validate findings with multiple methodologies to address potential technique-specific limitations

What considerations are important when using recombinant rat SSTR5 for structural and functional studies?

When working with recombinant rat SSTR5:

  • Expression System Selection:

    • Insect cell expression systems have been successfully used for structural studies

    • Co-expression with heterotrimeric G proteins and stabilizing antibody fragments (like scFv16) enhances stability

  • Receptor Stabilization:

    • Consider introducing stabilizing mutations (e.g., L6.40 mutation used in structural studies maintained normal receptor function)

    • Assess effects of any modifications through functional assays

  • Ligand Selection:

    • Different ligands induce distinct conformational states

    • Cyclic peptides like CST17 and octreotide have been successfully used in structural studies

  • Functional Validation:

    • Verify that recombinant SSTR5 maintains appropriate:

      • Ligand binding affinity

      • G protein coupling

      • Signaling properties

      • Response to known agonists/antagonists

  • Structural Analysis Considerations:

    • Be aware of potential limitations in modeling certain regions (N and C termini showed limited density in cryo-EM structures)

    • Consider the impact of fusion partners or tags on receptor function

How can researchers effectively analyze contradictory data in SSTR5 developmental expression studies?

When faced with contradictory data such as the discrepancy between SSTR5 mRNA and protein detection in embryonic studies:

  • Technical Validation:

    • Employ multiple primer sets for RT-PCR to rule out technical limitations

    • Verify antibody specificity through knockout controls or competing peptides

    • Use multiple detection methods (in situ hybridization, RT-PCR, immunohistochemistry, Western blot)

  • Tissue-Specific Analysis:

    • Whole embryo preparations may dilute tissue-specific signals

    • Consider microdissection to isolate specific tissues of interest

    • Perform single-cell RNA sequencing to detect cell-specific expression patterns

  • Developmental Timeline Considerations:

    • Increase sampling frequency during critical developmental windows

    • Consider potential transient expression patterns that might be missed with limited timepoints

  • Post-Transcriptional Regulation Assessment:

    • Investigate microRNA regulation of SSTR5 mRNA

    • Assess mRNA stability through actinomycin D chase experiments

    • Examine potential alternative splicing events

  • Data Integration Framework:

    • Create a comprehensive table comparing results across methodologies and developmental timepoints

    • Weight evidence based on methodological strengths and limitations

    • Consider biological explanations for apparent contradictions

What are promising approaches for developing SSTR5-selective therapeutic agents?

Based on recent structural and functional insights:

  • Structure-Guided Design:

    • Leverage the high-resolution cryo-EM structures of SSTR5 bound to CST17 and octreotide

    • Focus on exploiting the "hydrophobic lock" mechanism for selective activation

    • Design peptides or small molecules that specifically engage the unique features of the SSTR5 binding pocket

  • Extracellular Loop Targeting:

    • Develop compounds that specifically interact with the extracellular loops of SSTR5, which play a crucial role in ligand selectivity

    • Consider the polar network formed by Q99^2.63, T185^ECL2, and N187^45.51 as a potential target

  • Biased Agonism Exploration:

    • Design ligands that selectively activate specific downstream pathways

    • Study the distinct conformational states induced by different ligands to understand the structural basis of biased signaling

  • Heterodimer-Specific Approaches:

    • Develop compounds that specifically target SSTR5-SSTR2 heterodimers, which show enhanced growth inhibition activity

    • Consider bivalent ligands that can simultaneously engage both receptors in the heterodimer

How can advanced genetic models improve our understanding of SSTR5 function in physiological and pathological conditions?

Several genetic approaches offer promising avenues for SSTR5 research:

  • Conditional Knockout Models:

    • Generate tissue-specific and inducible SSTR5 knockout rat models

    • Study the temporal and spatial requirements for SSTR5 in development and disease

    • Assess compensatory mechanisms involving other somatostatin receptor subtypes

  • Knock-in Models with Reporter Tags:

    • Create knock-in models expressing SSTR5 fused to fluorescent proteins or epitope tags

    • Enable real-time visualization of receptor trafficking and localization

    • Facilitate isolation of SSTR5-expressing cells for transcriptomic and proteomic analysis

  • CRISPR-Based Approaches:

    • Introduce specific mutations identified in structural studies to validate their functional significance in vivo

    • Create models expressing humanized SSTR5 for better translational relevance

    • Generate models with mutations that affect heterodimer formation to study SSTR5-SSTR2 interactions

  • Disease Models:

    • Introduce SSTR5 mutations or expression changes associated with human diseases

    • Study the role of SSTR5 in models of neuroendocrine tumors, pituitary disorders, and pancreatic dysfunction

    • Evaluate potential therapeutic interventions targeting SSTR5

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.