Recombinant Rat Spastin (Spast)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics

Recombinant Rat Spastin (Spast) is a genetically engineered protein corresponding to the microtubule-severing enzyme spastin, produced in heterologous expression systems. It belongs to the AAA (ATPases Associated with various cellular Activities) protein family and plays critical roles in axonal development, microtubule dynamics, and neurodegenerative disease pathologies, particularly Hereditary Spastic Paraplegia (HSP) .

Key Features

  • Function: Catalyzes microtubule severing to regulate cytoskeletal architecture and cellular processes like intracellular trafficking and organelle biogenesis .

  • Structure: Contains a conserved ATPase domain and microtubule-binding domain (MTBD). Phosphorylation at Ser233 (rat-specific residue) modulates its interaction with regulatory proteins like 14-3-3 .

  • Pathological Relevance: Mutations in the SPAST gene (encoding spastin) are the most common cause of autosomal dominant HSP .

Production and Purification Methods

Recombinant Rat Spastin is produced via bacterial or mammalian expression systems, with optimization strategies tailored to yield functional protein.

ParameterE. coli System Mammalian System (HEK293T)
Expression HostE. coliHEK293T
YieldHigh efficiencyModerate efficiency
Post-Translational ModificationsNone (bacterial)Phosphorylation, glycosylation
Purity>85% (SDS-PAGE)>80% (Coomassie blue staining)
TagNot specifiedC-Myc/DDK

Purification Workflow

  1. Bacterial Expression: Induction of recombinant spastin in E. coli, followed by inclusion body solubilization and refolding .

  2. Mammalian Expression: Transfection of HEK293T cells with spastin cDNA, followed by affinity chromatography (anti-DDK) and conventional chromatography .

  3. Quality Control: SDS-PAGE, Western blotting, and ATPase activity assays to confirm integrity and functionality .

Domain Architecture

  • MTBD: Critical for microtubule binding and severing. Truncation of this domain abolishes microtubule interaction .

  • ATPase Domain: Required for enzymatic activity. Mutations in this region disrupt energy-dependent microtubule severing .

  • Phosphorylation Sites: Rat spastin’s Ser233 is phosphorylated in a 14-3-3-dependent manner, enhancing protein stability and microtubule-severing efficiency .

Functional Interactions

  • 14-3-3 Binding: Phosphorylated spastin interacts with 14-3-3 isoforms, preventing ubiquitination and degradation. This interaction is conserved across mammalian species .

  • MDM2 Regulation: MDM2 binds spastin independently of its E3 ligase activity, modulating its levels in post-transcriptional pathways .

Neurodegeneration and Regeneration

  • Nerve Regeneration: 14-3-3 agonists (e.g., FC-A) enhance spastin stability, promoting axonal regeneration in spinal cord injury models .

  • HSP Pathogenesis: Loss-of-function mutations in spastin disrupt microtubule dynamics, leading to axonal degeneration. Recombinant spastin studies validate its role in HSP pathology .

Biochemical Characterization

AssayOutcomeSource
ATPase ActivityConformation-dependent ATP hydrolysis
Microtubule SeveringDose-dependent severing of MTs in vitro
Protein Stability14-3-3 binding increases half-life by 2-3×

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments default to blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Spast; Spg4; Spastin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-581
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Spast
Target Protein Sequence
MSSPAGRRKKKGSGGASPAPARPPPPAAVPAPAAGPAPAPGSPHKRNLYYFSYPLVVGFA LLRLLACHLGLLFVWLCQRFSRALMAAKRSSGTAPAPASPSTPAPGPGGEAESVRVFHKQ AFEYISIALRIDEEEKGQKEQAVEWYKKGIEELEKGIAVIVTGQGEQYERARRLQAKMMT NLVMAKDRLQLLESGAVPKKKDPLTHASNSLPRSKTVMKSGSTGLSGHHRAPSCSGLSMV SGARPGSGPAATTHKGTSKPNRTNKPSTPTTAVRKKKDLKNFRNVDSNLANLIMNEIVDN GTAVKFDDIAGQELAKQALQEIVILPSLRPELFTGLRAPARGLLLFGPPGNGKTMLAKAV AAESNATFFNISAASLTSKYVGEGEKLVRALFAVARELQPSIIFIDEVDSLLCERREGEH DASRRLKTEFLIEFDGVQSAGDDRVLVMGATNRPQELDEAVLRRFIKRVYVSLPNEETRL LLLKNLLCKQGSPLTQKELAQLARMTDGYSGSDLTALAKDAALGPIRELKPEQVKNMSAS EMRNIRLSDFTESLKKIKRSVSPQTLEAYIRWNKDFGDTTV
Uniprot No.

Target Background

Function

Spastin is an ATP-dependent microtubule-severing protein with specific recognition and cleavage activity towards polyglutamylated microtubules. It exhibits preferential activity towards microtubules with short polyglutamate tails; severing activity increases with the number of glutamates per tubulin (from one to eight), then decreases beyond this threshold. This activity is independent of tubulin acetylation or detyrosination. Microtubule severing facilitates the reorganization of cellular microtubule arrays and the release of microtubules from the centrosome post-nucleation. Spastin is crucial for the biogenesis and maintenance of complex microtubule arrays within axons, spindles, and cilia. It plays a role in cytokinesis abscission and nuclear envelope reassembly during anaphase, cooperating with the ESCRT-III complex. Localized to the midbody, likely via IST1, Spastin participates in membrane fission during abscission alongside the ESCRT-III complex. Recruited to the nuclear membrane by IST1, it mediates microtubule severing, promoting nuclear envelope sealing and mitotic spindle disassembly in late anaphase. Furthermore, Spastin is involved in membrane trafficking from the endoplasmic reticulum (ER) to the Golgi apparatus and endosome recycling. IST1 recruits it to endosomes, where it regulates early endosomal tubulation and recycling through microtubule severing. Spastin likely contributes to axon growth and the formation of axonal branches.

Database Links
Protein Families
AAA ATPase family, Spastin subfamily
Subcellular Location
Membrane; Peripheral membrane protein. Endoplasmic reticulum. Midbody. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region. Nucleus. Cytoplasm, cytoskeleton, spindle. Cytoplasm.

Q&A

What is recombinant rat spastin and what cellular functions does it regulate?

Spastin is a microtubule-severing protein encoded by the SPAST gene that plays critical roles in neurite growth and regeneration by cleaving microtubules into smaller segments . The protein is crucial for several fundamental cellular processes, particularly in neurons. Mammalian cells express at least two major spastin isoforms, with the full-length protein having a calculated molecular weight of approximately 67 kDa, though the observed molecular weight on Western blots is typically around 52 kDa .

Functionally, spastin is involved in multiple cellular processes including cell division (specifically abscission during cytokinesis), endosomal trafficking, and axonal maintenance. Research has demonstrated that spastin deficiency results in delayed abscission, as detected by accumulation of cells connected by intercellular bridges, and transferrin receptor 1 (TfR1) sorting defects . These findings highlight spastin's essential role in membrane trafficking and cytoskeletal organization, particularly in neurons where its dysfunction leads to hereditary spastic paraplegia (HSP-SPG4).

What are the key spastin isoforms and their differential expression patterns?

Spastin exists in multiple isoforms, with the two predominant forms being the full-length M1 spastin (translated from the first start codon) and the shorter M87 spastin (translated from a second start codon at methionine 87 in humans, or methionine 85 in mouse) . These isoforms display distinct expression patterns and functions:

IsoformMolecular FeaturesExpression PatternFunctional Characteristics
M1 SpastinFull-length protein containing the N-terminal regionSignificantly expressed in adult spinal cord; limited detection in other tissuesInhibits fast axonal transport; potentially contributes to HSP pathology
M87 SpastinLacks the N-terminal region present in M1Widely expressed in neuronal and non-neuronal tissuesDoes not inhibit fast axonal transport; primary role in microtubule severing

Quantitative analyses have revealed that the adult spinal cord contains significant levels of the M1 isoform, which is not readily detectable in other nervous tissues at other developmental stages . This unique expression pattern may explain the selective vulnerability of specific neuronal populations in HSP. The differential effects of these isoforms on axonal transport suggest isoform-specific functions that may be critical for understanding disease mechanisms.

What are the optimal methods for producing recombinant rat spastin proteins?

The production of high-quality recombinant rat spastin requires careful consideration of expression systems and purification strategies. Based on published protocols, the following methodological approach is recommended:

  • Cloning Strategy: Mouse or rat cDNA encoding full-length spastin or specific isoforms (like M85 in mouse, equivalent to human M87) can be cloned into appropriate expression vectors. For mammalian expression, vectors like pEGFP (Clontech) with the spastin sequence downstream from an EGFP tag have proven effective .

  • Expression Systems:

    • For cellular studies: Transfection into mammalian cells (HeLa, RFL-6 fibroblasts) using Lipofectamine 2000 (typically 0.5–1 μg of DNA and 1.25–2.5 μg of Lipofectamine 2000 per 35-mm dish, with a DNA:Lipofectamine ratio of 1:2.5) .

    • For recombinant protein production: In vitro translation (IVT) procedures have been successfully employed to produce recombinant mutant spastin proteins .

  • Verification of Expression: Parallel IVT reactions in the presence of 35S-radiolabeled methionine can confirm translation of recombinant spastin proteins at the expected molecular weights .

For specific fragments of spastin intended for antibody production or structural studies, bacterial expression systems have been employed. For example, fragments of spastin cDNA encoding amino acids 333-465 or 90-283 have been successfully cloned into bacterial expression vectors like pRSET (Invitrogen) .

What detection methods are most effective for spastin in experimental samples?

Multiple detection methods have been validated for spastin, with specific considerations for different experimental contexts:

  • Western Blotting: Several antibodies have been developed for spastin detection by Western blot. The commercial antibody 22792-1-AP has been validated for WB applications at dilutions of 1:500-1:2000, with observed molecular weight around 52 kDa in HeLa and PC-3 cells . Custom polyclonal antibodies targeting specific domains (e.g., Sp/AAA targeting amino acids 333-465) have also been reported as effective for Western blotting .

  • Immunohistochemistry: For tissue sections, antibody 22792-1-AP has been validated for IHC at dilutions of 1:50-1:500, with recommended antigen retrieval using TE buffer pH 9.0 or citrate buffer pH 6.0 .

  • Immunofluorescence: For cellular localization studies, antibodies like 22792-1-AP can be used at dilutions of 1:200-1:800 for immunofluorescence/immunocytochemistry in cells like HeLa . Custom antibodies targeting specific regions (e.g., Sp/Sp5 targeting amino acids 90-283) have also shown effectiveness for immunostaining .

  • Recombinant Tagged Proteins: Expression of EGFP-tagged spastin provides another detection strategy, particularly useful for live-cell imaging and localization studies .

How do mutations in spastin affect axonal transport and contribute to disease pathology?

Research has revealed critical insights into how spastin mutations impact axonal transport and contribute to hereditary spastic paraplegia pathogenesis. Vesicle motility assays following perfusion of human mutant spastin polypeptides have shown isoform-specific effects:

  • The M1 isoform containing mutations (including E442Q, C448Y, L195V, and E112K) markedly inhibits both anterograde and retrograde fast axonal transport (FAT) . This suggests a toxic gain-of-function mechanism rather than simple haploinsufficiency.

  • In contrast, the M87 isoform bearing the same mutations does not affect FAT , highlighting the critical role of the N-terminal region unique to M1 in mediating these toxic effects.

These findings challenge the traditional loss-of-function model for HSP pathogenesis, suggesting that accumulation of the M1 isoform or expression of mutant M1 spastin may actively contribute to disease through toxic effects on axonal transport. The unique expression of M1 spastin in adult spinal cord may explain the selective vulnerability of specific neuronal populations in HSP .

What is the relationship between MDM2 and spastin regulation in neuronal models?

Recent research has identified MDM2 as a novel regulator of spastin protein levels through the following mechanisms:

  • MDM2 downregulation increases spastin levels: siRNA-mediated knockdown of MDM2 in HeLa cells results in increased spastin protein levels, with similar effects observed in H1299 cells and HIPK2-Cas9 HeLa cells .

  • MDM2 inhibition via Nutlin-3a increases spastin levels: Pharmacological inhibition of MDM2 using Nutlin-3a increases spastin levels in multiple cell types, including:

    • Human SH-SY5Y neuron-like cells

    • Murine motor neuron-like NSC-34 cells

    • Patient-derived SPG4-lymphoblastoid cell lines (SPG4-LCLs) carrying a heterozygous c751insA truncating mutation

  • Functional rescue: The Nutlin-3a-induced increase in spastin levels can rescue functional defects associated with spastin reduction, including:

    • Reduced accumulation of cells at the cytokinesis stage

    • Recovery of TfR1 protein levels

    • Enhanced cellular uptake of fluorescent FtH nanocarriers

This regulatory mechanism appears to be HIPK2- and p53-independent, with evidence supporting a direct interaction between MDM2 and spastin's MIT domain. The discovery provides new therapeutic targets for addressing spastin deficiency in HSP patients.

What experimental systems are available for studying spastin function in neuronal contexts?

Several experimental systems have been validated for investigating spastin function in neuronal contexts:

  • Primary Neuronal Cultures: Rat hippocampal neurons have been effectively used for spastin studies, with transfection achieved using Lipofectamine 2000 or Nucleofector technology .

  • Neuronal Cell Lines:

    • Human SH-SY5Y neuron-like cells

    • Murine motor neuron-like NSC-34 cells
      Both have been employed for studying spastin regulation and function

  • Patient-Derived Cells: SPG4-LCLs carrying specific mutations provide a disease-relevant model for studying spastin function and potential therapeutic interventions .

  • siRNA-Based Models: siRNA-mediated knockdown of spastin in HeLa cells or neuronal cultures has been used to mimic haploinsufficiency and study associated functional defects . Specifically:

    • Nucleofector technology can be used to transfect neurons with spastin-specific siRNA (available as "smartpools" from commercial sources)

    • Control experiments typically use non-specific siRNA sequences that do not correspond to any gene in the rat genome

  • Axoplasm Vesicle Motility Assays: These assays have been instrumental in evaluating the effects of different spastin isoforms and mutations on fast axonal transport .

How can spastin levels be experimentally manipulated for functional studies?

Multiple approaches have been validated for manipulating spastin levels in experimental systems:

  • Downregulation Strategies:

    • siRNA-mediated knockdown using smartpools of four sequences specific to rodent spastin has proven effective in neuronal cultures, with transfection achieved using Nucleofector technology

    • This approach mimics haploinsufficiency observed in HSP patients and results in specific cellular phenotypes including delayed abscission and TfR1 sorting defects

  • Upregulation Strategies:

    • MDM2 inhibition: Nutlin-3a treatment increases spastin levels in multiple cell types, including neuronal cell lines and patient-derived cells

    • MDM2 knockdown: siRNA-mediated downregulation of MDM2 increases spastin protein levels

  • Expression of Mutant Forms:

    • Transfection with constructs encoding various spastin mutants (E442Q, C448Y, L195V, E112K) in either the M1 or M87 isoform background allows investigation of mutation-specific effects

    • Co-expression with other proteins like tau can provide insights into functional interactions

Each approach has specific applications and limitations that should be considered based on the research question. For functional recovery studies, the MDM2 inhibition approach has shown promise in rescuing defects associated with spastin reduction .

What functional assays can evaluate spastin activity in cellular and molecular systems?

Several functional assays have been developed to assess spastin activity and the consequences of its dysfunction:

  • Cytokinesis/Abscission Assays: Quantification of cells connected by intercellular bridges (ICBs) provides a measure of abscission efficiency, which is delayed in spastin-deficient cells .

  • Transferrin Receptor (TfR1) Sorting Assays:

    • Western blot analysis of TfR1 protein levels

    • Cellular uptake of fluorescent FtH nanocarriers (whose internalization is mediated by FtH/TfR1 receptor binding)

  • Vesicle Motility Assays: These assays measure the rates of anterograde and retrograde fast axonal transport following perfusion with recombinant spastin proteins, providing direct insights into spastin's effects on axonal transport .

  • Microtubule Severing Assays: Visual or biochemical assessment of microtubule fragmentation in the presence of active spastin.

  • Poly-ubiquitination Assays: For investigating spastin regulation, assessing poly-ubiquitination levels provides insights into protein stability and degradation mechanisms .

These functional assays provide complementary information about spastin's diverse cellular roles and can be selected based on the specific aspect of spastin biology under investigation.

What therapeutic approaches target spastin regulation for potential HSP treatment?

Recent discoveries regarding spastin regulation have opened new avenues for therapeutic intervention in HSP:

  • MDM2 Inhibition: Nutlin-3a treatment increases spastin levels and rescues functional defects associated with spastin reduction, including abscission delays and TfR1 sorting defects . This approach has shown efficacy in:

    • Human SH-SY5Y neuron-like cells

    • Murine motor neuron-like NSC-34 cells

    • Patient-derived SPG4-LCLs

  • Targeting Spastin Degradation Pathways: The identification of MDM2 as a spastin interactor that regulates its poly-ubiquitination suggests multiple potential intervention points in the spastin degradation pathway . Future research may explore:

    • Inhibitors of specific E3 ubiquitin ligase complexes involved in spastin degradation

    • Modulators of spastin-specific deubiquitinases

    • Compounds affecting the interaction between spastin and factors recruiting it to E3 Ubiquitin ligase complexes

  • Isoform-Specific Approaches: The differential effects of M1 and M87 spastin isoforms on axonal transport suggest that selectively targeting the toxic effects of mutant M1 spastin might provide therapeutic benefit while preserving the essential functions of M87 spastin .

These emerging approaches challenge the traditional view of HSP as purely a loss-of-function disease and suggest that combination strategies targeting both loss-of-function and toxic gain-of-function mechanisms may be most effective.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.