Recombinant Rat Sphingosine 1-phosphate receptor 1 (S1pr1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes section, and we will fulfill your requirements to the best of our ability.
Lead Time
Delivery timelines may vary depending on your location and the purchasing method. For precise delivery estimates, we recommend contacting your local distributors.
Note: All our protein shipments include standard blue ice packs. If you require dry ice for shipping, please inform us in advance, as additional fees may apply.
Notes
We advise against repeated freezing and thawing. It is recommended to store working aliquots at 4°C for a maximum of one week.
Reconstitution
For optimal reconstitution, we suggest briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquoting for storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be minimized.
Tag Info
The tag type will be determined during the manufacturing process.
Should you have a specific tag type preference, please inform us, and we will prioritize its inclusion in the development process.
Synonyms
S1pr1; Edg1; Sphingosine 1-phosphate receptor 1; S1P receptor 1; S1P1; Endothelial differentiation G-protein coupled receptor 1; Sphingosine 1-phosphate receptor Edg-1; S1P receptor Edg-1; CD antigen CD363
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLI ILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFL REGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPI MGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRK NISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVL AVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSS HPQKDDGDNPETIMSSGNVNSSS
Uniprot No.

Target Background

Function
This G-protein coupled receptor binds to the bioactive lysosphingolipid sphingosine 1-phosphate (S1P), likely through interaction with the G(i) subclass of heteromeric G proteins. Activation of S1PR1 triggers a signaling cascade leading to the activation of RAC1, SRC, PTK2/FAK1, and MAP kinases. This receptor plays a crucial role in cellular migration, potentially by mediating the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that elevate SPHK1 activity. S1PR1 is essential for normal chemotaxis towards sphingosine 1-phosphate. It is also critical for proper embryonic heart development and cardiac morphogenesis. S1PR1 is significantly involved in the regulation of sprouting angiogenesis and vascular maturation, inhibiting excessive sprouting during blood vessel development. Additionally, it is necessary for the normal egress of mature T-cells from the thymus into the bloodstream and peripheral lymphoid organs. S1PR1 contributes to the migration of osteoclast precursor cells, the regulation of bone mineralization, and bone homeostasis. It also participates in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury.
Gene References Into Functions
  1. There is a marked up-regulation of S1PR1 in hippocampus following traumatic brain injury. PMID: 28018679
  2. Maternal lead exposure in the blood affects levels of sphingosine-1-phosphate (S1P) and expression of S1P receptor 1 in the brain of the rat in the perinatal period. PMID: 27697711
  3. S1P regulates cell proliferation and angiogenesis via different receptors. PMID: 26543024
  4. The neuronal sphingosine-1-phosphate/S1PR1/STAT3 signaling axis plays a critical role in the control of energy homeostasis. PMID: 25255053
  5. Research findings identify the S1P/S1PR1 axis as a promising molecular and therapeutic target in chemotherapy-induced painful peripheral neuropathy, providing mechanistic insight into the biomolecular signaling pathways involved. PMID: 24876379
  6. Restoring cardiac plasma membrane levels of S1PR1 produces beneficial effects that counteract the detrimental beta1AR overstimulation observed in heart failure. PMID: 23969695
  7. Data indicate that inhibiting S1PR1 or S1PR3 significantly reduced the velocity of S1P-induced VSMC migration by almost 75%. PMID: 22828274
  8. S1PR1 receptors in sensory ganglia cells play a pivotal role in regulating behavioral sensitivity during inflammation. PMID: 22445889
  9. Studies on single defined neurons demonstrate that S1PR(1) plays a prominent, though not exclusive, role in enhancing neuronal excitability. PMID: 22805346
  10. Analysis of quinolinone-based agonists of S1P. PMID: 22104144
  11. The sphingosine-1-phosphate (S1P)-to-S1PR-1 pathway is implicated as a downstream signaling pathway in ceramide-induced hyperalgesia. PMID: 21605625
  12. Purification and identification of activating enzymes of CS-0777, a selective sphingosine 1-phosphate receptor 1 modulator, in erythrocytes. PMID: 21613209
  13. FTY720 (Gilenya) phosphate selectivity of sphingosine 1-phosphate receptor subtype 1 (S1P1) G protein-coupled receptor requires motifs in intracellular loop 1 and transmembrane domain 2. PMID: 21719706
  14. Sphingosine 1-phosphate 1 receptor (S1P1R) agonists regulate podocyte-specific proteins. PMID: 21289599
  15. These findings indicate that S1PR(1) plays a prominent, although not exclusive, role in mediating the enhancement of excitability of sensory neurons. PMID: 20844107
  16. The activation of endothelial S1P(R1) is responsible for the protective action of sphingosine-1-phosphate on microvessel permeability. PMID: 20729401
  17. PKC inhibition may contribute to lymphopenia by down-regulating S1P(1) receptor cell surface expression independently from its activation. PMID: 20032465
  18. This lipid mediator in neural stem/progenitor cell migration may have therapeutic potential in spinal cord injury. PMID: 16990586
  19. These results indicate that CNS S1P receptors are part of a physiologically relevant and widespread neuromodulatory system, and that the S1P(1) receptor contributes to S1P-mediated antinociception. PMID: 19493165

Show More

Hide All

Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome. Membrane raft.

Q&A

What is the physiological role of Sphingosine 1-phosphate receptor 1 in normal cellular function?

Sphingosine 1-phosphate receptor 1 (S1pr1) functions as a G protein-coupled receptor that mediates multiple physiological processes upon activation by its ligand, sphingosine-1-phosphate (S1P). Primary functions include:

  • Regulation of immune cell trafficking, particularly T cell migration between lymphoid organs and circulation

  • Maintenance of T cell survival through inhibition of apoptotic pathways

  • Contribution to vascular development and maintenance of endothelial barrier integrity

  • Cellular proliferation and migration signaling

S1pr1 achieves these effects by activating various intracellular signaling pathways, most notably through Gi protein coupling, which leads to inhibition of adenylate cyclase and activation of downstream effectors including Akt and ERK-1/2 . The receptor plays a critical role in maintaining appropriate levels of naïve T cells within the lymphoid system, which is essential for effective immunity requiring a large, diverse repertoire circulating among lymphoid organs in search of antigen .

How does S1pr1 differ structurally and functionally from other S1P receptor subtypes?

S1pr1 is one of five sphingosine-1-phosphate receptors (S1pr1-5), each with distinct structural features and signaling properties:

  • Coupling specificity: S1pr1 couples exclusively to Gi proteins, while other subtypes like S1pr2 and S1pr3 can couple to multiple G proteins including Gi, Gq, and G12/13

  • C-terminal domain: The C-terminus of S1pr1 contains specific residues essential for receptor internalization and anti-apoptotic signaling, a feature not shared by all S1P receptors

  • Tissue distribution: S1pr1 is widely expressed in various tissues but has particularly important roles in the immune and vascular systems, while other subtypes show more restricted expression patterns

  • Ligand affinity: S1pr1 displays high affinity for S1P and specific synthetic agonists like SEW2871 and RP-001

  • Pharmacological responses: S1pr1 shows distinct responses to modulators, with specific agonists and antagonists that do not affect other subtypes with the same potency or efficacy

These differences enable targeted pharmaceutical interventions and explain why S1pr1-specific drugs have proven useful in treating conditions like multiple sclerosis and ulcerative colitis .

What experimental validation methods confirm the identity and integrity of recombinant rat S1pr1?

Several methodological approaches can validate recombinant rat S1pr1:

Protein Characterization Techniques:

  • Western blot analysis using specific antibodies like the 2B9 monoclonal antibody

  • Immunoprecipitation to isolate and confirm protein interactions

  • Mass spectrometry for sequence verification and post-translational modification analysis

Functional Validation:

  • Ligand binding assays using radiolabeled or fluorescent S1P

  • G protein coupling assays measuring inhibition of cAMP or activation of downstream signaling

  • β-arrestin recruitment assays to confirm receptor functionality

  • Akt phosphorylation assays, which confirm downstream signaling capacity

Imaging Approaches:

  • Immunocytochemistry to visualize receptor localization using specific antibodies

  • Internalization assays with S1P or FTY720-P to confirm proper trafficking

  • GFP-fusion protein imaging to track receptor movement in real-time

The 2B9 monoclonal antibody has been specifically developed for detection of both human and mouse S1pr1 (with cross-reactivity to rat), making it particularly useful for validation in various experimental settings .

What in vivo models are most effective for studying S1pr1 function and signaling?

Several in vivo models have proven effective for studying S1pr1 function:

S1pr1 GFP Signaling Mice:
This mouse model contains an S1pr1 fusion protein with a transcription factor linked by a protease cleavage site at the C-terminus, along with a β-arrestin/protease fusion protein. Upon S1pr1 activation, the transcription factor is released, stimulating GFP reporter gene expression, allowing real-time visualization of receptor activation throughout tissues .

Key advantages:

  • Allows in vivo tracking of receptor activation under physiological and pathological conditions

  • Enables assessment of agonist effects in specific tissues and cell types

  • Facilitates detection of endogenous S1P signaling during inflammation and other processes

In normal conditions, these mice exhibit S1pr1 activation in endothelial cells of lymphoid tissues and cells in the splenic marginal zone. During LPS-induced systemic inflammation, activation expands to include hepatocytes via hematopoietically-derived S1P .

Other Effective Models:

  • Conditional S1pr1 knockout mice for tissue-specific function analysis

  • Knock-in models with tagged receptors for trafficking studies

  • Rats with reporter gene constructs for pharmacokinetic/pharmacodynamic studies

These models are particularly valuable when assessing potential therapeutics targeting S1pr1, as they allow observation of both on-target effects and potential off-target consequences in complex physiological systems.

How can researchers establish reliable cell-based assays for S1pr1 functional studies?

Establishing reliable cell-based assays for S1pr1 functional studies requires careful consideration of multiple factors:

Cell Line Selection:

  • Mouse embryonic fibroblasts (MEFs) provide a clean background for engineered S1pr1 expression systems

  • Immortalized stem cells expressing S1pr1 naturally (such as iSCAP cells) can measure physiologically relevant responses

  • HEK293 or CHO cells for standardized overexpression systems with predictable background signaling

Key Functional Assays:

  • Akt Phosphorylation Assay:

    • Measures S1pr1-Gi signaling through detection of phosphorylated Akt (Ser473)

    • Can detect activation by S1P, RP-001, and SEW2871 with dose-dependent responses

    • Method: Western blot analysis following brief stimulation (5-15 minutes)

  • Receptor Internalization Assay:

    • Monitors receptor trafficking following ligand binding

    • Employs immunofluorescence or fluorescent protein-tagged receptors

    • Quantified via high-content imaging or flow cytometry

  • β-arrestin Recruitment:

    • Utilizes BRET (Bioluminescence Resonance Energy Transfer) or FRET

    • Provides real-time kinetic data on receptor activation

  • ERK1/2 Phosphorylation:

    • Downstream marker of receptor activation

    • Shows biphasic response useful for distinguishing agonist characteristics

Validation and Controls:

  • Include positive controls with known S1pr1 agonists (S1P, RP-001, SEW2871)

  • Negative controls with non-ligands (sphingosine, LPA)

  • Confirm specificity with S1pr1 antagonists (e.g., SB649146)

  • Verify receptor expression levels via immunoblotting or flow cytometry

Sensitivity Considerations:

  • Ensure detection systems can measure physiologically relevant concentrations

  • Establish dose-response curves covering pM to μM range

  • Account for S1P presence in serum when designing experiments

For optimal reproducibility, researchers should standardize cell culture conditions, passage numbers, and serum starvation protocols to minimize variability in receptor expression and baseline activation.

What expression systems yield the highest quality recombinant rat S1pr1 for structural and functional studies?

Several expression systems have been utilized for producing recombinant S1pr1, each with distinct advantages:

Yeast Expression Systems:
Pichia pastoris has proven effective for producing S1pr1 for antibody generation and structural studies .

  • Advantages:

    • Post-translational modifications similar to mammalian systems

    • High protein yield

    • Ability to grow at high cell densities

    • Less complex glycosylation that can facilitate crystallization

  • Optimization parameters:

    • Codon optimization for yeast expression

    • Signal sequence selection

    • Induction timing and temperature

Mammalian Expression Systems:

  • HEK293 cells:

    • Most physiologically relevant post-translational modifications

    • Proper folding and trafficking

    • Suitable for functional studies requiring native receptor behavior

  • CHO cells:

    • Stable cell lines with consistent expression

    • Scalable production

    • Lower background signaling for certain pathways

Insect Cell Expression:

  • Baculovirus-infected Sf9 or Hi5 cells

  • Compromise between bacterial yield and mammalian processing

  • Effective for structural biology applications

Expression Tags and Purification Strategies:

  • FLAG or His tags for affinity purification

  • Inclusion of TEV cleavage sites to remove tags post-purification

  • Thermostability-enhancing mutations to improve yield

  • Addition of T4 lysozyme or other stabilizing proteins for crystallography

For applications requiring highly pure, functional S1pr1, mammalian expression systems generally yield superior results despite lower protein quantities. For structural studies or antibody production, yeast systems like Pichia pastoris offer an excellent compromise between yield and quality .

How does S1pr1 signaling regulate T cell survival and migration?

S1pr1 plays a critical dual role in T cell biology by regulating both survival and migration through distinct but interconnected signaling mechanisms:

T Cell Survival Regulation:
Contrary to initial expectations, S1pr1 limits T cell apoptosis through a specific molecular cascade:

  • S1pr1 activation restrains c-Jun N-terminal kinase (JNK) activity in T cells

  • Controlled JNK activity maintains the appropriate balance of BCL2 family members

  • This balance prevents activation of pro-apoptotic pathways

  • The process requires specific C-terminal residues of S1pr1 that enable receptor internalization

This mechanism explains why patients treated with S1PR1 antagonists like ozanimod and fingolimod may experience sustained reductions in circulating lymphocytes beyond what can be explained by trafficking effects alone.

T Cell Migration Control:
S1pr1 orchestrates T cell movement between lymphoid organs and circulation:

  • S1P gradients exist between lymph/blood (high S1P) and lymphoid tissues (low S1P)

  • T cells with surface S1pr1 follow this gradient to exit lymphoid tissues

  • Upon encountering high S1P concentrations, S1pr1 is internalized

  • Reduced surface S1pr1 allows T cells to re-enter lymphoid tissues where S1P concentrations are lower

Disruption of this cycle by S1PR1 antagonists causes T cell sequestration in lymphoid organs, preventing their participation in inflammatory responses in target tissues like the central nervous system or colon .

The intertwining of these two functions—survival and migration—explains why patients receiving S1PR1-targeting drugs show both immediate trafficking effects and longer-term alterations in T cell populations, including poor responses to vaccines .

What downstream pathways are activated upon S1pr1 stimulation in different cell types?

S1pr1 activates various downstream pathways depending on cell type, with significant heterogeneity in signaling outcomes:

Lymphocytes:

  • Gi-mediated inhibition of adenylyl cyclase → decreased cAMP

  • PI3K activation → Akt phosphorylation → enhanced survival signaling

  • Rac activation → cytoskeletal rearrangements driving migration

  • JNK inhibition → balanced BCL2 family expression → apoptosis prevention

Endothelial Cells:

  • Gi/PI3K/Akt activation → enhanced barrier integrity

  • Rac1 activation → cortical actin assembly

  • eNOS phosphorylation → NO production → vasodilation

  • VE-cadherin stabilization at adherens junctions

Hepatocytes:

  • S1P activation during inflammatory conditions

  • Altered metabolic enzyme regulation

  • Protection against ischemia-reperfusion injury

Dental Stem Cells:

  • Increased expression of odontogenic differentiation markers:

    • Dentin sialophosphoprotein

    • Dentin matrix phosphoprotein 1

    • Matrix extracellular phosphoglycoprotein

  • Enhanced mineralization

  • Suppression of adipocyte differentiation

Cell-type specific signaling regulation:
The variety of responses appears dependent on:

  • Differential expression of downstream effector proteins

  • Compartmentalization of signaling complexes

  • Cell-type specific receptor trafficking patterns

  • Crosstalk with other signaling pathways

Understanding these cell-type specific signaling patterns is crucial for predicting both therapeutic effects and potential side effects of S1pr1-targeting pharmaceuticals.

What is the significance of S1pr1 internalization and recycling in signal regulation?

S1pr1 internalization and recycling represent sophisticated regulatory mechanisms that determine signaling duration, intensity, and specificity:

Internalization Mechanisms:

  • Agonist-induced: Upon S1P binding, GRK (G protein-coupled receptor kinase) phosphorylates S1pr1, promoting β-arrestin recruitment

  • β-arrestin-dependent: Recruitment of β-arrestin leads to receptor uncoupling from G proteins and clathrin-mediated endocytosis

  • C-terminal residue requirement: Specific C-terminal residues of S1pr1 are essential for both internalization and anti-apoptotic signaling

Functional Consequences of Internalization:

  • Signal termination: Primary mechanism for ending G protein-dependent signaling

  • Signal transduction: Internalized receptors continue signaling through β-arrestin-dependent pathways

  • Receptor fate determination: Receptors are sorted for recycling or degradation

  • Cellular responsiveness regulation: Controls sensitivity to extracellular S1P gradients

Recycling Dynamics:

  • Fast recycling pathway: Rapid return to cell surface (minutes)

  • Slow recycling pathway: Return via recycling endosomes (hours)

  • Degradative pathway: Lysosomal targeting and proteolytic destruction

Pharmacological Implications:
Different S1pr1-targeting drugs have distinct effects on internalization and recycling:

  • Functional antagonists (fingolimod/FTY720-P, ozanimod): Induce profound internalization and degradation

  • Competitive antagonists (SB649146): Block S1P binding but may cause partial internalization

  • Protean agonists (SB649146): Can act as inverse agonists, competitive antagonists, or partial agonists depending on context

Visualization and Measurement:
The 2B9 monoclonal antibody allows visualization of S1pr1 trafficking, revealing that stimulation with S1P or FTY720-P induces receptor internalization . This tool enables tracking of endogenous receptor movements rather than relying on overexpressed tagged proteins.

The complex internalization and recycling mechanisms explain why S1pr1-targeting drugs have prolonged effects on immune cell trafficking and why receptor desensitization may contribute to therapeutic efficacy in conditions like multiple sclerosis and ulcerative colitis.

How do S1pr1 antagonists affect immune responses within lymph nodes beyond blocking egress?

S1pr1 antagonists have more complex effects on immune function than simply preventing lymphocyte egress from lymph nodes:

Impact on Naïve T Cell Survival:

  • S1pr1 antagonists like fingolimod (FTY720) and ozanimod disrupt pro-survival signaling

  • This leads to increased apoptosis in naïve T cells through elevated JNK activation

  • The resulting imbalance in BCL2 family proteins promotes cell death pathways

  • Long-term treatment can significantly deplete the naïve T cell repertoire

Consequences for Lymph Node Immune Responses:

  • Impaired vaccine responses: Patients on S1PR1 antagonists show poor responses to SARS-CoV-2 vaccines

  • Correlation with treatment duration: Antibody titers negatively correlate with time on drug

  • Incomplete recovery: Some patients do not fully recover lymphocyte counts after discontinuing treatment

Mechanistic Explanation:
The impaired antibody responses despite B cell responses being initiated within lymph nodes can be explained by:

  • Loss of naïve T cell repertoire required for effective T-dependent B cell responses

  • Disruption of T-B cell interactions within lymphoid tissue

  • Altered follicular helper T cell development and function

  • Compromised germinal center formation and maintenance

Clinical Implications:
These findings suggest both limitations and potential new applications for S1PR1 antagonists:

  • Timing considerations: Vaccination may be more effective before initiating therapy

  • Dosing strategies: Intermittent dosing might preserve T cell pools better than continuous treatment

  • Novel applications: Targeted depletion of specific T cell subsets could be therapeutic in certain conditions

Understanding these broader effects on lymphoid tissue immune responses is essential for optimizing treatment protocols and anticipating potential immune-related adverse events in patients receiving S1PR1-targeted therapies.

What methodologies are most effective for screening novel S1pr1 modulators?

Effective screening of novel S1pr1 modulators requires a strategic combination of in vitro and in vivo approaches:

In Vitro Primary Screening Methods:

  • Ligand Binding Assays:

    • Competitive displacement of radiolabeled S1P or fluorescent S1P analogs

    • Scintillation proximity assays (SPA) for high-throughput capability

    • Time-resolved fluorescence resonance energy transfer (TR-FRET)

  • Functional Signaling Assays:

    • Gi-coupled cAMP inhibition assays

    • Akt phosphorylation detection via AlphaScreen or HTRF technologies

    • ERK1/2 phosphorylation assays using cell-based ELISA formats

    • β-arrestin recruitment using BRET or enzyme complementation

  • Receptor Trafficking Analysis:

    • High-content imaging of receptor internalization

    • Flow cytometry measuring surface receptor expression

    • Pulse-chase studies for receptor fate determination

Secondary Validation Approaches:

  • Selectivity Profiling:

    • Counter-screening against other S1P receptor subtypes (S1pr2-5)

    • Broader GPCR panel screening to identify off-target activities

    • Assessment in protean agonism models to detect context-dependent signaling

  • S1pr1 GFP Signaling Cell Lines:

    • MEFs containing the modified S1pr1 signaling pathway

    • Allow visualization of nuclear GFP fluorescence upon receptor activation

    • Enable comparison with reference compounds (RP-001, SEW2871, dihydro-S1P)

  • Complex Cellular Models:

    • T cell migration assays using transwell systems

    • Endothelial barrier function measurements

    • Primary cell activation and differentiation assessments

In Vivo Evaluation in S1pr1 GFP Signaling Mice:
These mice provide a powerful platform for evaluating compounds in vivo:

  • Allow visualization of tissue-specific receptor activation

  • Enable detection of both on-target and off-target effects

  • Permit assessment of compound distribution and pharmacodynamics

  • Facilitate comparison with established S1pr1 modulators

Screening Cascade Example for Novel S1pr1 Modulators:

Screening PhaseAssay TypePurposeKey Parameters
PrimaryBinding assayInitial hit identificationIC50 for S1P displacement
PrimaryGi signalingFunctional activity confirmation% inhibition of cAMP
SecondaryAkt phosphorylationDownstream signaling profileEC50/IC50
SecondaryReceptor internalizationFunctional antagonism assessment% internalization at 1μM
SecondaryS1P receptor panelSelectivity determinationBinding ratios (S1pr1:other)
TertiaryT cell migrationCellular function validationMigration inhibition IC50
In vivoS1pr1 GFP miceTarget engagement confirmationGFP signal in target tissues

The complex pharmacology of S1pr1 modulators—including potential protean agonism as seen with compounds like SB649146—necessitates this comprehensive cascade approach to accurately characterize novel compounds .

What role does S1pr1 play in odontogenic differentiation and dental tissue regeneration?

S1pr1 has emerged as a significant regulator of odontogenic differentiation, with important implications for dental tissue regeneration strategies:

Expression Pattern in Dental Tissues:

  • S1PR1-positive cells are present in the apical papilla of immature rat molars

  • S1PR1 is expressed at the dentin-pulp interface where odontoblast-like cells reside

  • The receptor shows increased expression during odontogenic differentiation

Molecular Mechanisms in Odontogenic Differentiation:
S1P promotes odontogenic differentiation of immortalized stem cells of dental apical papilla (iSCAP) through S1PR1 signaling by:

  • Increasing expression of odontogenic differentiation markers:

    • Dentin sialophosphoprotein (DSPP)

    • Dentin matrix phosphoprotein 1 (DMP1)

    • Matrix extracellular phosphoglycoprotein (MEPE)

  • Enhancing mineralization capacity:

    • S1P treatment increases calcium deposition as visualized by Alizarin red staining

    • This effect is mediated specifically through S1PR1 signaling pathways

  • Suppressing differentiation toward other lineages:

    • S1P via S1PR1 inhibits adipogenic differentiation

    • This is demonstrated by reduced Oil red O staining in S1P-treated cells

S1PR1 Signaling Pathway Specificity:
The effects of S1P on odontogenic differentiation involve S1PR1-specific signaling, as demonstrated by:

  • The progressive increase in S1PR1 mRNA expression during differentiation

  • The enhancement of this expression by S1P treatment

  • The lack of significant effects on S1PR2 expression

Comparison with Other Differentiation Factors:
While bone morphogenetic protein-9 (BMP-9) also promotes odontogenic differentiation of dental stem cells, its mechanism differs from S1P:

  • BMP-9 increases S1PR1 expression only at day 7 of differentiation

  • BMP-9 effects are not dependent on S1PR1 signaling

  • S1P effects are specifically mediated through S1PR1

Implications for Regenerative Endodontics:
These findings suggest promising applications in dental regeneration:

  • S1PR1 modulators could enhance stem cell-based pulp regeneration

  • Targeting S1PR1 might promote differentiation of resident dental stem cells

  • Combined approaches using S1P and growth factors like BMP-9 might yield synergistic effects

  • Biomaterials incorporating S1P or S1PR1 agonists could enhance dental tissue engineering

Understanding S1PR1's role in dental stem cell differentiation provides a foundation for developing novel regenerative strategies for damaged dental tissues, particularly in the context of regenerative endodontics for immature permanent teeth.

How can researchers distinguish between S1pr1-specific effects and those mediated by other S1P receptors in complex biological systems?

Distinguishing S1pr1-specific effects from those mediated by other S1P receptors in complex biological systems presents significant challenges that require sophisticated methodological approaches:

Pharmacological Approaches:

  • Selective Agonists and Antagonists:

    • Use highly selective S1pr1 agonists like SEW2871 and RP-001

    • Apply selective antagonists with verified specificity profiles

    • Implement dose-response studies to identify receptor-specific thresholds

    • Control for protean agonism effects that may complicate interpretation

  • Receptor Subtype Differential Expression:

    • Profile S1P receptor expression in target tissues/cells via qPCR

    • Perform Western blot analysis with subtype-specific antibodies like 2B9

    • Use immunohistochemistry to map receptor distribution patterns

Genetic Approaches:

  • Conditional Knockout Models:

    • Generate tissue-specific S1pr1 knockout models

    • Compare with wild-type responses to distinguish receptor contributions

    • Utilize temporal control (inducible systems) to avoid developmental compensation

  • siRNA/shRNA Knockdown:

    • Perform targeted knockdown of S1pr1 while preserving other subtypes

    • Verify knockdown specificity with antibodies like 2B9

    • Assess restoration of phenotype with rescue experiments

  • S1pr1 Reporter Systems:

    • Implement S1pr1 GFP signaling mice or cells for direct visualization

    • Monitor activation patterns in response to stimuli

    • Compare with non-specific S1P receptor activators

Biochemical Verification Techniques:

  • Receptor-Specific Signaling Fingerprints:

    • S1pr1 couples exclusively to Gi; other subtypes show broader coupling

    • Measure pertussis toxin sensitivity to identify Gi-dependent effects

    • Analyze pathway-specific phosphorylation patterns

  • Protein-Protein Interaction Analysis:

    • Perform immunoprecipitation with S1pr1-specific antibodies

    • Analyze interactome differences between receptor subtypes

    • Identify unique binding partners as potential effect mediators

Comprehensive Analytical Framework:

ApproachTechniqueAdvantagesLimitations
PharmacologicalSelective agonists/antagonistsTemporal control, dose-dependentOff-target effects at high concentrations
GeneticConditional knockoutTissue-specific insights, complete eliminationDevelopmental compensation, technical complexity
GeneticsiRNA/shRNACell-type specific, titratableIncomplete knockdown, transient effects
ReporterS1pr1 GFP fusionDirect visualization, temporal resolutionPotential alteration of signaling dynamics
BiochemicalPertussis toxin sensitivityDistinguishes Gi-specific signalingDoes not separate between Gi-coupled receptors
BiochemicalImmunoprecipitation/proteomicsIdentifies specific complexesLimited to stable interactions

By implementing multiple complementary approaches from this framework, researchers can build a strong case for S1pr1-specific effects versus those mediated by other S1P receptors in complex biological systems.

What are the critical considerations when designing experiments to study S1pr1 trafficking and internalization?

Designing robust experiments to study S1pr1 trafficking and internalization requires attention to multiple technical and biological factors:

Receptor Expression Systems:

  • Endogenous vs. Overexpression:

    • Overexpressed receptors may exhibit altered trafficking kinetics

    • Endogenous receptor detection requires sensitive tools like the 2B9 antibody

    • Consider quantitative comparisons of expression levels relative to physiological conditions

  • Fusion Protein Considerations:

    • C-terminal tags may interfere with trafficking machinery interactions

    • N-terminal tags can affect ligand binding

    • Small tags (FLAG, HA) generally cause less disruption than larger fluorescent proteins

    • Validate that tagged receptors retain normal signaling properties

Experimental Design Parameters:

  • Temporal Considerations:

    • Establish appropriate time courses (seconds to hours)

    • Include early time points (30s, 1min, 2min) to capture rapid events

    • Monitor long-term fate (recycling vs. degradation) over 24-48 hours

    • Consider pulse-chase approaches to track receptor cohorts

  • Ligand Selection and Concentration:

    • Use physiologically relevant S1P concentrations (10-100 nM)

    • Include FTY720-P as a functional antagonist comparison

    • Test concentration-dependence to distinguish high vs. low affinity responses

    • Account for endogenous S1P in serum-containing media

  • Temperature Controls:

    • Conduct experiments at physiological temperature (37°C)

    • Include 4°C controls to isolate binding from internalization

    • Consider temperature shifts to synchronize trafficking events

Detection Methodologies:

  • Immunocytochemistry/Microscopy:

    • Surface vs. intracellular staining protocols to distinguish locations

    • Live-cell imaging for real-time trafficking visualization

    • Fixed-cell analysis for precise colocalization studies

    • Confocal microscopy for 3D resolution of subcellular compartments

  • Biochemical Approaches:

    • Surface biotinylation to quantify plasma membrane receptor pools

    • Immunoprecipitation from membrane fractions

    • Protease protection assays to determine topology

  • Flow Cytometry:

    • High-throughput quantification of surface receptor levels

    • Antibody feeding assays to track internalization kinetics

    • Intracellular vs. surface staining to determine receptor distribution

Critical Controls and Validations:

  • Trafficking Pathway Verification:

    • Colocalization with pathway-specific markers:

      • Early endosomes: EEA1, Rab5

      • Recycling endosomes: Rab11

      • Late endosomes/lysosomes: LAMP1, Rab7

    • Pathway disruption using chemical inhibitors or dominant-negative constructs

  • Specificity Controls:

    • siRNA knockdown of S1pr1 to verify antibody specificity

    • Blocking peptides for immunocytochemistry

    • Competition with unlabeled antibodies

By carefully addressing these considerations in experimental design, researchers can generate reliable data on S1pr1 trafficking that accurately reflects physiological processes rather than technical artifacts.

What are the emerging approaches for investigating S1pr1 conformational changes and structure-function relationships?

Investigating S1pr1 conformational changes and structure-function relationships represents a frontier in GPCR research, with several cutting-edge approaches offering new insights:

Advanced Structural Biology Techniques:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of multiple receptor conformational states

    • Requires less protein than crystallography, reducing aggregation challenges

    • Can capture S1pr1 in complex with various signaling partners

    • Allows study of conformational ensembles rather than static structures

  • X-ray Crystallography Optimizations:

    • Lipidic cubic phase (LCP) crystallization for membrane proteins

    • Fusion protein approaches to stabilize specific conformations

    • Thermostabilizing mutations to improve crystal quality

    • Fragment-based approaches to identify binding sites

  • NMR Spectroscopy Applications:

    • Methyl-TROSY NMR for large membrane proteins

    • Site-specific isotope labeling to track conformational changes

    • 19F NMR for monitoring ligand-induced conformational shifts

    • Solid-state NMR for membrane-embedded receptors

Computational and Molecular Dynamics Approaches:

  • Molecular Dynamics Simulations:

    • All-atom simulations in explicit membrane environments

    • Coarse-grained approaches for extended timescale events

    • Enhanced sampling techniques to capture rare conformational transitions

    • Markov state modeling to identify metastable conformational states

  • Structure-Based Virtual Screening:

    • Docking against multiple receptor conformations

    • Fragment-based approaches to identify novel binding pockets

    • Molecular mechanics/generalized Born surface area (MM/GBSA) calculations

    • AI/machine learning integration for improved binding prediction

Biophysical Techniques for Conformational Analysis:

  • Single-Molecule FRET:

    • Tracks conformational changes in real-time

    • Detects transient intermediates missed by ensemble methods

    • Provides distance measurements between receptor domains

    • Can be combined with functional assays for correlation

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Maps solvent accessibility changes upon ligand binding

    • Identifies regions undergoing conformational shifts

    • Requires relatively small amounts of purified receptor

    • Compatible with detergent-solubilized or nanodisc-reconstituted receptors

  • Site-Directed Fluorescence Spectroscopy:

    • Environmentally sensitive fluorophores at key positions

    • Monitors conformational changes in response to ligands

    • Can be adapted for high-throughput screening

    • Allows real-time kinetic measurements

Emerging Genetic and Chemical Biology Approaches:

  • Site-Specific Unnatural Amino Acid Incorporation:

    • Introduces photocrosslinking residues to capture transient interactions

    • Incorporates spectroscopic probes at precise locations

    • Creates site-specific chemical handles for modification

    • Generates minimally perturbing modifications

  • GPCR-Specific Biosensors:

    • Conformationally sensitive nanobodies that recognize active states

    • Intramolecular FRET/BRET sensors reporting receptor activation

    • Split luciferase complementation systems for protein-protein interactions

    • Transcriptional reporters like the S1P1 GFP signaling system

  • Receptor Cross-Linking Approaches:

    • Disulfide cross-linking to stabilize specific conformations

    • Metal-ion coordination sites to constrain receptor mobility

    • Bi-functional ligands to induce specific conformational states

    • Covalent ligands to trap transitional states

By integrating multiple complementary approaches from this repertoire, researchers can develop comprehensive models of S1pr1 activation, signaling specificity, and biased agonism that inform both basic understanding and drug development.

What future directions in S1pr1 research are most promising for therapeutic development?

The current landscape of S1pr1 research points to several high-potential avenues for therapeutic development:

Targeting Specific S1pr1 Signaling Pathways:
Research into biased agonism—compounds that selectively activate certain downstream pathways while avoiding others—represents a particularly promising direction. This approach could separate beneficial effects of S1pr1 modulation from adverse consequences, potentially creating therapeutics with improved safety profiles compared to current non-selective functional antagonists .

Novel Applications Based on Survival Signaling:
The recently clarified role of S1pr1 in T cell survival through JNK inhibition and BCL2 family regulation opens new therapeutic opportunities. Beyond current applications in multiple sclerosis and ulcerative colitis, this mechanism could be leveraged for conditions requiring controlled reduction of specific T cell populations, including certain autoimmune disorders and transplantation settings .

Regenerative Medicine Applications:
S1pr1's role in stem cell differentiation, particularly in dental tissues, suggests applications in regenerative medicine. Development of targeted delivery systems incorporating S1P or selective S1pr1 modulators could enhance tissue regeneration protocols, especially in dental pulp regeneration and potentially other stem cell-based therapies .

Addressing Vaccination Responses:
The identification of impaired vaccine responses in patients on S1PR1 antagonists highlights an urgent need for strategies to optimize immunization in these individuals. Research into timing of vaccination relative to dosing, alternative vaccination protocols, or adjuvant approaches specifically designed for patients on these medications could significantly improve clinical outcomes .

As our understanding of the complex biology of S1pr1 continues to expand, these research directions hold promise for developing more targeted, effective, and safer therapeutic interventions across multiple disease areas.

What are the most significant technical challenges in S1pr1 research and how can they be addressed?

Research on S1pr1 faces several technical challenges that require innovative solutions:

Challenge 1: Receptor Specificity Determination
The high sequence and functional similarity between S1P receptor subtypes makes attribution of specific effects challenging.

Solutions:

  • Development of more selective pharmacological tools with improved subtype specificity

  • Generation of conditional tissue-specific knockout models for precise comparison

  • Implementation of CRISPR-based approaches for receptor editing

  • Utilization of specific monoclonal antibodies like 2B9 for detection and characterization

Challenge 2: S1P Availability and Stability Issues
S1P presents unique handling challenges due to its lipid nature, poor water solubility, and tendency to bind to plastics and glassware.

Solutions:

  • Standardized protocols for S1P preparation and storage

  • Use of carrier proteins (BSA) at consistent concentrations

  • Implementation of glass containers with silanized surfaces

  • Development of more stable S1P analogs for experimental consistency

Challenge 3: Quantifying Receptor Activation in Complex Tissues
Detecting S1pr1 activation in vivo remains difficult due to transient signaling events and complex cellular environments.

Solutions:

  • Wider application of reporter systems like S1pr1 GFP signaling mice

  • Development of phospho-specific antibodies for downstream effectors

  • Implementation of single-cell analysis techniques to resolve cell-specific responses

  • Application of spatial transcriptomics to map activation patterns

Challenge 4: Translating Between Model Systems and Human Disease
Species differences in S1pr1 expression, distribution, and signaling present challenges for clinical translation.

Solutions:

  • Development of humanized mouse models

  • Validation in patient-derived samples when possible

  • Careful consideration of species differences in experimental design

  • Implementation of in silico approaches to predict cross-species differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.