Recombinant Rat Squalene monooxygenase (Sqle)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please communicate it to us, and we will prioritize developing the specified tag.
Synonyms
Sqle; Erg1; Squalene monooxygenase; Squalene epoxidase; SE
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-573
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Sqle
Target Protein Sequence
MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRNGGLLGRHQSGS QFAAFSDILSALPLIGFFWAKSPPESEKKEQLESKRRRKEVNLSETTLTGAATSVSTSSV TDPEVIIIGSGVLGSALATVLSRDGRTVTVIERDLKEPDRILGECLQPGGYRVLRELGLG DTVESLNAHHIHGYVIHDCESRSEVQIPYPVSENNQVQSGVAFHHGKFIMSLRKAAMAEP NVKFIEGVVLRLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKNLISNKVS VSSHFVGFIMKDAPQFKANFAELVLVDPSPVLIYQISPSETRVLVDIRGELPRNLREYMT EQIYPQIPDHLKESFLEACQNARLRTMPASFLPPSSVNKRGVLLLGDAYNLRHPLTGGGM TVALKDIKIWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRSHSFVVNVLAQALYELFSATD DSLRQLRKACFLYFKLGGECLTGPVGLLSILSPDPLLLIRHFFSVAVYATYFCFKSEPWA TKPRALFSSGAILYKACSIIFPLIYSEMKYLVH
Uniprot No.

Target Background

Function
Catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. This enzyme is considered a rate-limiting factor in steroid biosynthesis.
Gene References Into Functions
  1. Functional promoter regions involved in transcription have been determined. PMID: 12083769
  2. Phosphorylation of supernatant protein factor enhances its ability to stimulate this enzyme in liver microsomes. PMID: 12454003
  3. Aromatic residues are likely located within the substrate-binding domain of the active site, controlling the stereochemical course of the squalene epoxidase reaction. PMID: 17112472
Database Links
Protein Families
Squalene monooxygenase family
Subcellular Location
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.
Tissue Specificity
Detected in lever (at protein level).

Q&A

What is squalene monooxygenase and what is its role in cholesterol biosynthesis?

Squalene monooxygenase (SQLE, also known as squalene epoxidase, EC 1.14.14.17) is a key rate-limiting enzyme in the cholesterol biosynthetic pathway. It catalyzes the first oxygenation step, converting squalene to 2,3-oxidosqualene (monooxidosqualene). This reaction requires molecular oxygen to introduce an epoxide group that ultimately forms the signature C3-hydroxyl group of cholesterol. Additionally, SQLE can further catalyze the conversion of monooxidosqualene to 2,3;22,23-dioxidosqualene, which is a precursor to the regulatory oxysterol 24(S),25-epoxycholesterol . As a flux-controlling enzyme, SQLE represents the second rate-limiting step in cholesterol biosynthesis, positioned downstream of 3-hydroxy-3-methylglutaryl-CoA reductase (HMGCR) .

Why is recombinant rat SQLE important for research applications?

Recombinant rat SQLE serves as a valuable model system for investigating fundamental aspects of cholesterol biosynthesis regulation. The rat enzyme shares significant structural and functional homology with human SQLE while offering experimental advantages. Recombinant expression provides researchers with a consistent source of purified enzyme for structural studies, inhibitor screening, and mechanistic investigations. The rat model has contributed substantially to our understanding of SQLE's catalytic properties, regulatory mechanisms, and role in cholesterol homeostasis . Furthermore, studying recombinant rat SQLE facilitates comparative analyses with human SQLE to identify conserved features that could be targeted for therapeutic interventions in cholesterol-related disorders and certain cancers .

What expression systems are most effective for producing recombinant rat SQLE?

Escherichia coli has been successfully employed as an expression system for recombinant rat SQLE (rSE). A particularly effective approach involves using SQLE cDNA with strategic modifications. Researchers have achieved robust expression by deleting nucleotides coding for 99 amino acids in the N-terminal region while adding a hexa-histidine tag at the C-terminal end . This modified construct facilitates efficient expression in E. coli and subsequent purification. The N-terminal truncation likely improves expression by removing membrane-associated domains that could impair proper folding in prokaryotic systems. When considering expression design, it's important to note that similar strategies have been successfully applied to related proteins like rat supernatant protein factor (SPF), which has been cloned, expressed, and purified following heterologous expression in E. coli .

What is the optimal purification protocol for recombinant rat SQLE?

A highly effective two-step chromatography protocol has been established for purifying recombinant rat SQLE from E. coli. The procedure begins with Ni-chelate affinity agarose chromatography, exploiting the C-terminal hexa-histidine tag for selective binding. This is followed by Cibacron Blue Sepharose column chromatography as a polishing step . This protocol achieves approximately 100-fold purification over crude E. coli extract with yields of about 50%, resulting in enzyme preparations that demonstrate a single band on SDS-polyacrylamide gel electrophoresis, indicating apparent homogeneity . For optimal results, purification should be performed under conditions that maintain enzyme stability, typically including appropriate buffers, reducing agents, and sometimes detergents to preserve the active conformation of the enzyme. Researchers should verify purity through both SDS-PAGE and activity assays to ensure the final preparation maintains catalytic functionality.

How can researchers confirm the identity and activity of purified recombinant rat SQLE?

Confirming the identity and activity of purified recombinant rat SQLE involves multiple complementary approaches:

  • Electrophoretic Analysis: SDS-PAGE should show a single band of the expected molecular weight. For truncated rSE with a hexa-histidine tag, this would be consistent with the predicted size based on amino acid composition .

  • Spectroscopic Characterization: The enzyme typically shows no distinct absorption spectrum in the visible regions .

  • Activity Assays: Functional verification requires demonstrating squalene conversion to 2,3-oxidosqualene (monooxidosqualene) and 2,3;22,23-dioxidosqualene in a reconstituted system. Key components for this assay include:

    • Purified enzyme

    • NADPH as an electron donor

    • FAD as a cofactor

    • Squalene substrate

    • Appropriate detergent (e.g., Triton X-100) or lipid environment

    • NADPH-cytochrome c reductase as an electron transfer component

  • Inhibitor Sensitivity: Confirm characteristic sensitivity to known SQLE inhibitors like NB-598, which should inhibit the purified enzyme at concentrations consistent with literature values .

  • pH Dependency Profile: Verify that the pH dependency for enzyme activity matches that of the native rat liver microsomal enzyme .

What are the key structural domains of rat SQLE and their functions?

Rat SQLE contains several distinct structural domains with specific functions:

  • N-terminal Regulatory Domain (SM-N100): This domain (approximately the first 100 amino acids) serves as a lipid-sensing region that detects sterol and squalene levels in the endoplasmic reticulum membrane. It contains a hydrophobic re-entrant loop (residues ~15-40) that likely interacts with lipid substrates . This domain plays a crucial role in regulating enzyme stability and degradation in response to metabolic conditions.

  • Catalytic Domain: Located C-terminal to the regulatory domain, this region contains the active site responsible for the epoxidation reaction. Key features include:

    • Binding sites for squalene and FAD cofactor

    • Aromatic and leucine residues that line the active site and are required for catalysis

    • The critical residue Y195, which when mutated to phenylalanine (Y195F) renders the enzyme catalytically inactive

  • C-terminal Region: May be involved in protein-protein interactions or additional regulatory functions, though less extensively characterized than the N-terminal and catalytic domains.

The full enzyme exhibits complex regulation, while a truncated form lacking most of the N-terminal regulatory domain (trunSM) retains catalytic activity but becomes resistant to cholesterol-mediated inhibition, rendering it constitutively active .

How does rat SQLE compare structurally and functionally with human SQLE?

While the search results don't provide direct comprehensive comparison between rat and human SQLE, several key similarities and differences can be inferred:

  • Structural Homology: The human SQLE structure has been solved through crystallography of its catalytic domain alone and in complex with inhibitors . Based on functional similarities, rat SQLE likely shares significant structural homology with human SQLE, especially in the catalytic domain.

  • Substrate Specificity: Both rat and human SQLE catalyze the same reactions - conversion of squalene to monooxidosqualene and further to dioxidosqualene - suggesting conserved active site architecture .

  • Regulatory Mechanisms: Both enzymes appear to be regulated by similar mechanisms, including N-terminal domain-mediated sensing of lipid levels and degradation via the ubiquitin-proteasome pathway .

  • Pharmacological Response: Both rat and human enzymes are inhibited by compounds like NB-598, indicating conserved binding sites for these inhibitors .

  • Truncation Phenomenon: Research has documented that both rat and human SQLE can be partially degraded to form a truncated, constitutively active enzyme (trunSM) .

The structural insights from human SQLE studies have facilitated the development of improved inhibitors with potential applications in both cholesterol reduction and cancer therapy .

What cofactors and environmental conditions are required for optimal rat SQLE activity?

Optimal activity of recombinant rat SQLE requires specific cofactors and environmental conditions:

Essential Cofactors:

  • FAD: Serves as a critical cofactor for the oxidation reaction

  • NADPH: Functions as the electron donor

  • NADPH-cytochrome c reductase: Required for electron transfer in the reaction system

Environmental Requirements:

  • Detergent or Lipid Environment: Either the S105 fraction or Triton X-100 is necessary to provide an appropriate hydrophobic environment for the enzyme and substrate

  • Molecular Oxygen: Required as a substrate for the epoxidation reaction

  • Appropriate pH: The enzyme exhibits specific pH dependency for optimal activity, which should match that of rat liver microsomal SQLE

Stimulatory Factors:

  • Supernatant Protein Factor (SPF): Cytosolic protein that enhances SQLE activity by promoting the intermembrane transfer of squalene

  • SPF-like protein (SPF2): Related protein that also stimulates SQLE activity, though only about half as effectively as SPF

Activity can be further modulated by:

  • Phosphorylation by protein kinase A, which can increase activity approximately two-fold

  • Guanine nucleotides (GTP, GDP), which can inhibit enzyme activity

  • Alpha-tocopherol, which can prevent the inhibitory effects of guanine nucleotides

How is rat SQLE activity regulated at the post-translational level?

Rat SQLE undergoes sophisticated post-translational regulation through several mechanisms:

  • Ubiquitination and Proteasomal Degradation: SQLE is subject to regulation via ubiquitination and subsequent proteasomal degradation. The N-terminal regulatory domain (SM-N100) senses lipid levels in the endoplasmic reticulum membrane and modulates degradation rates accordingly. Excess cholesterol accelerates degradation, while excess squalene attenuates it .

  • Partial Proteolysis and Truncation: Incomplete proteasomal degradation can produce a truncated form of SQLE (trunSM) that lacks a large portion of the lipid-sensing N-terminal domain but retains the full catalytic domain. This truncated form is resistant to cholesterol-mediated inhibition, rendering it constitutively active .

  • Substrate-Induced Regulation: Squalene and its oxygenated derivatives (monooxidosqualene and dioxidosqualene) can induce SQLE truncation, promoting the formation of the constitutively active trunSM. This appears to occur via the SM-N100 regulatory domain rather than through direct binding to the catalytic domain .

  • Modulation by Protein Factors: Supernatant protein factor (SPF) and its homolog SPF2 stimulate SQLE activity. For SPF2, this stimulation can be enhanced approximately two-fold through phosphorylation by protein kinase A and ATP .

  • Nucleotide-Mediated Regulation: Guanine nucleotides (GTP and GDP) can inhibit SQLE activity, with SPF2 being more strongly inhibited than SPF. This inhibition can be fully prevented by alpha-tocopherol, suggesting complex interplay between different regulatory molecules .

  • Hypoxia-Induced Regulation: Hypoxic conditions trigger the accumulation of trunSM, likely through squalene accumulation resulting from reduced oxygen availability for the epoxidation reaction .

What role does supernatant protein factor (SPF) play in regulating rat SQLE activity?

Supernatant protein factor (SPF) is a crucial regulatory protein that significantly impacts rat SQLE activity through several mechanisms:

  • Direct Stimulation of Enzyme Activity: SPF promotes the squalene epoxidation reaction catalyzed by rat liver microsomes in systems containing oxygen, NADPH, FAD, and phospholipid. This stimulatory effect was first identified by Bloch and colleagues in 1957 and has been confirmed with recombinant SPF produced in E. coli .

  • Intermembrane Squalene Transfer: SPF facilitates the transfer of squalene between membranes in vitro. As a cytosolic lipid-binding/transfer protein, SPF likely enhances substrate availability to membrane-bound SQLE, thereby increasing reaction rates .

  • Tissue-Specific Expression: SPF is abundantly expressed in the liver and small intestine, both major sites of cholesterol biosynthesis. This expression pattern aligns with its role in regulating cholesterol production .

  • Enhanced Cholesterol Synthesis: Transfection of SPF cDNA in McARH7777 cells significantly stimulates de novo cholesterol biosynthesis, demonstrating its physiological importance in regulating the cholesterol synthetic pathway .

  • Structural Features: SPF belongs to a family of cytosolic lipid-binding/transfer proteins that includes α-tocopherol transfer protein, cellular retinal binding protein, and phosphatidylinositol transfer protein. This structural classification provides insights into its functional mechanisms .

The related protein SPF2 shares 90% sequence identity with rat SPF and also stimulates SQLE activity, though only half as effectively as SPF. SPF2 appears to be predominantly expressed in respiratory and epithelial tissues, whereas SPF is primarily expressed in the liver, suggesting tissue-specific regulatory mechanisms .

How does hypoxia affect rat SQLE activity and structure?

Hypoxia significantly impacts rat SQLE through several interrelated mechanisms:

  • Induction of SQLE Truncation: Hypoxic conditions trigger the partial degradation of SQLE to form a truncated version (trunSM) that lacks most of the N-terminal regulatory domain but retains the full catalytic domain. This truncated form is constitutively active as it is resistant to cholesterol-mediated inhibition .

  • Squalene Accumulation: Hypoxia causes squalene to accumulate, likely due to reduced oxygen availability for the epoxidation reaction. This accumulated squalene further promotes SQLE truncation, creating a positive feedback loop. There is a strong correlation between squalene levels and trunSM formation, suggesting truncation is triggered by very small quantities of squalene .

  • Dual Regulatory Mechanisms: Squalene can regulate SQLE through two distinct mechanisms:

    • Promoting partial degradation to form the constitutively active trunSM

    • Blunting MARCHF6-mediated ubiquitination of the N-terminal domain, leading to stabilization of full-length SQLE

    This enables a biphasic response to squalene accumulation, with truncation potentially stimulated at a lower squalene threshold than inhibition of ubiquitination .

  • Failsafe Mechanism: The squalene-induced truncation may function as a "failsafe" mechanism to preserve SQLE activity when reduction in MARCHF6-mediated ubiquitination is insufficient to completely prevent targeting of SQLE to the proteasome, or when SQLE ubiquitination is promoted by other simultaneous cellular stimuli .

  • Physiological Significance: This hypoxia-induced regulation may represent an adaptive mechanism to maintain cholesterol synthesis under low-oxygen conditions. The constitutively active trunSM could potentially continue producing essential oxysterols even when oxygen is limited, though further research is needed to fully elucidate the physiological importance of this phenomenon .

What are the optimal assay conditions for measuring recombinant rat SQLE activity?

To accurately measure recombinant rat SQLE activity, researchers should implement the following optimized assay conditions:

Basic Reaction Components:

  • Purified recombinant rat SQLE

  • Squalene substrate at appropriate concentrations

  • Molecular oxygen supply

  • NADPH as electron donor (freshly prepared)

  • FAD as essential cofactor

  • NADPH-cytochrome c reductase for electron transfer

  • Buffer system maintaining optimal pH (matching that of rat liver microsomal SQLE)

Environmental Factors:

  • Either S105 fraction or Triton X-100 to provide a suitable hydrophobic environment

  • Temperature control (typically 37°C)

  • Protection from light for photosensitive components like FAD

Detection Methods:

  • Thin-layer chromatography (TLC) for separating and identifying reaction products (monooxidosqualene and dioxidosqualene)

  • HPLC or GC-MS for more quantitative analysis of products

  • Radiometric assays using labeled substrates for enhanced sensitivity

Controls and Validation:

  • Include NB-598 as a specific inhibitor control

  • Use catalytically inactive Y195F mutant as a negative control

  • Incorporate comparative assays with rat liver microsomal SQLE to benchmark activity

Optional Enhancement:

  • Addition of supernatant protein factor (SPF) to stimulate activity and intermembrane transfer of squalene

  • Pre-incubation with protein kinase A and ATP if studying phosphorylation-mediated regulation

For studying truncation phenomena, researchers can monitor the trunSM:SM ratio using immunoblotting techniques with antibodies specific to the catalytic domain (to detect both full-length and truncated forms) .

How can researchers effectively study SQLE degradation and truncation mechanisms?

To investigate SQLE degradation and truncation mechanisms, researchers should consider the following methodological approaches:

Cell Culture and Treatment Conditions:

  • Hypoxia Induction: Use controlled hypoxic chambers to create low-oxygen environments (typically 1-5% O₂) to trigger squalene accumulation and subsequent SQLE truncation .

  • Chemical Treatments:

    • NB-598 (SQLE inhibitor) to induce truncation

    • Exogenous squalene, monooxidosqualene, or dioxidosqualene addition to study substrate-induced truncation

    • Proteasome inhibitors to block degradation and study ubiquitination patterns

Molecular Tools:

  • Gene Modification:

    • Generate SQLE-knockout cell lines using CRISPR/Cas9

    • Create point mutations in potential regulatory sites (e.g., Y195F catalytically inactive mutant)

    • Develop truncation-resistant constructs by modifying the N-terminal domain

  • Protein Detection:

    • Western blotting with antibodies against different SQLE domains to distinguish full-length and truncated forms

    • Use epitope tags (V5, His, etc.) to track transfected constructs

    • Polyubiquitination detection to monitor degradation signals

Experimental Approaches:

  • Pulse-Chase Experiments: Use metabolic labeling to track SQLE protein stability and degradation kinetics under different conditions.

  • Biochemical Fractionation: Separate cellular compartments to study the subcellular localization of different SQLE forms.

  • Protein-Protein Interaction Studies: Investigate associations with components of the ubiquitin-proteasome system, particularly MARCHF6, which is implicated in SQLE regulation .

  • Domain-Specific Analysis: Express individual domains (e.g., SM-N100) to study their specific roles in sensing lipid levels and regulating degradation.

Quantification and Analysis:

What genetic and protein engineering approaches can be used to study specific aspects of rat SQLE function?

Researchers can employ several genetic and protein engineering strategies to investigate specific aspects of rat SQLE function:

Domain Truncation and Deletion:

  • N-terminal Domain Removal: Deleting the first 99 amino acids (as in the expression system described) provides a construct lacking the regulatory domain while maintaining catalytic activity .

  • Targeted Domain Deletions: Creating precise deletions (e.g., SM[ΔN65]-V5) to study the contribution of specific regions to enzyme function, regulation, and stability .

Site-Directed Mutagenesis:

  • Catalytic Site Mutations: Introducing mutations like Y195F to create catalytically inactive enzymes that can still bind substrate but not convert it, useful for studying binding without catalysis .

  • Regulatory Domain Mutations: Modifying putative squalene-binding residues (e.g., phenylalanine and leucine residues in the re-entrant loop) to investigate their role in substrate sensing and enzyme regulation .

  • Ubiquitination Site Mutations: Altering lysine residues that serve as ubiquitination targets to create degradation-resistant variants.

Fusion Proteins and Tags:

  • Epitope Tags: Adding C-terminal hexa-histidine tags for purification and detection .

  • Fluorescent Protein Fusions: Creating GFP or similar fusions to study subcellular localization and trafficking.

  • Split Protein Complementation: Using techniques like bimolecular fluorescence complementation to study protein-protein interactions involving SQLE.

Expression Systems:

  • Bacterial Expression: Using E. coli for high-yield production of recombinant protein .

  • Mammalian Expression: Transfecting SQLE constructs into cell lines to study regulation in a native-like environment, particularly in SQLE-knockout backgrounds to eliminate endogenous enzyme effects .

  • Inducible Expression: Developing tetracycline-regulated or similar systems to control timing and level of SQLE expression.

CRISPR/Cas9 Genome Editing:

  • Gene Knockout: Creating SQLE-deficient cell lines as backgrounds for structure-function studies .

  • Knock-in Modifications: Introducing specific mutations or tags at the endogenous locus to study the protein under physiological regulation.

These approaches can be combined with biochemical assays and structural analyses to comprehensively investigate SQLE function, regulation, and potential as a therapeutic target.

How do rat and human SQLE differ in their responses to known inhibitors?

While the search results don't provide extensive direct comparison of inhibitor responses between rat and human SQLE, we can extract some relevant information and insights:

Similarities in Inhibitor Response:

  • Both rat and human SQLE are sensitive to NB-598, a specific SQLE inhibitor .

  • For both species, NB-598 appears to induce SQLE truncation by binding and stabilizing the catalytic domain .

  • The conserved response to this inhibitor suggests structural similarity in the drug-binding pocket between rat and human enzymes.

Mechanistic Insights:

  • In human SQLE, structural studies have elucidated the mechanism of action for pharmacological inhibitors. The crystal structure of human SQLE's catalytic domain has been solved both alone and in complex with two similar inhibitors .

  • This structural information facilitates the development of improved inhibitors with potential applications in treating cholesterol-related disorders and certain cancers .

  • The rat enzyme likely shares these structural features given its functional similarity.

Research and Therapeutic Implications:

  • Human SQLE is increasingly recognized as an oncogene and potential cancer therapy target, particularly for neuroendocrine tumors where SQLE inhibition causes toxic accumulation of squalene .

  • Rat SQLE continues to serve as an important model system for understanding basic enzyme mechanisms.

  • The development of specific inhibitors targeting conserved features between rat and human SQLE could potentially lead to new cholesterol-lowering drugs and anti-cancer therapies .

For researchers designing inhibitor studies, it would be prudent to test compounds against both rat and human enzymes to identify both conserved and species-specific responses, especially when using the rat model to develop potential human therapeutics.

What insights from rat SQLE research have translated to human disease applications?

Research on rat SQLE has provided valuable insights with significant translational implications for human disease:

  • Cholesterol Regulation Mechanisms: Studies of rat SQLE have helped elucidate fundamental mechanisms of cholesterol biosynthesis regulation. Understanding how supernatant protein factor (SPF) enhances rat SQLE activity and promotes de novo cholesterol biosynthesis has informed approaches to modulating cholesterol production in humans.

  • Hypoxia Response Pathways: The discovery that hypoxia induces rat SQLE truncation to a constitutively active form provides insights into how cholesterol metabolism adapts to low-oxygen environments. This has potential implications for understanding cholesterol synthesis in hypoxic conditions like ischemic tissues, solid tumors, and high-altitude adaptation.

  • Cancer Therapy Applications: Research on SQLE inhibitors initially tested in rat models has contributed to the identification of human SQLE as a bona fide oncogene and target in cancer therapy . Notably, SQLE has been identified as a unique vulnerability in a subset of neuroendocrine tumors, where inhibition causes toxic accumulation of squalene .

  • Natural Product Effects: Understanding how rat SQLE is regulated has helped explain the cholesterol-lowering effects of natural products found in foods like garlic, red wine, and green tea . These insights support nutritional and supplementation approaches to managing cholesterol levels in humans.

  • Structural Insights for Drug Development: Comparative studies between rat and human SQLE have informed structural biology approaches that subsequently led to solving the human SQLE structure . This structural information is facilitating the development of improved inhibitors for potential therapeutic applications.

The continued study of rat SQLE provides a valuable model system that complements human SQLE research, particularly for mechanistic investigations that may be challenging to perform directly with human tissues or in clinical settings.

What are the current challenges and future directions in recombinant rat SQLE research?

Current challenges and future research directions for recombinant rat SQLE include:

Technical Challenges:

  • Membrane Association: The hydrophobic nature and membrane association of SQLE complicate expression, purification, and structural studies. Developing improved systems for producing full-length enzyme without compromising the N-terminal regulatory domain remains challenging .

  • Reconstitution of Native Environment: Creating experimental systems that accurately reflect the enzyme's native lipid environment in the endoplasmic reticulum membrane is difficult but essential for understanding physiological regulation.

  • Quantitative Analysis of Lipid Interactions: Developing methods for precisely measuring interactions between SQLE and its lipid substrates/regulators (squalene, sterols) with sufficient sensitivity is technically demanding .

Future Research Directions:

  • Detailed Truncation Mechanism: Elucidating the exact molecular mechanisms by which squalene promotes SQLE truncation, including:

    • Identifying the specific cleavage sites

    • Characterizing the proteases involved

    • Understanding how squalene binding to the N-terminal domain triggers partial degradation

  • Comprehensive Structural Studies: While human SQLE structure has been partly solved , further structural work on rat SQLE, particularly including the regulatory N-terminal domain, would provide valuable insights into species-specific features.

  • Physiological Significance of Truncation: Investigating the biological importance of SQLE truncation under various conditions:

    • Determining if truncation serves as an adaptive mechanism during hypoxia

    • Exploring potential roles in disease contexts

    • Examining tissue-specific regulation patterns

  • Interaction Networks: Mapping the complete protein-protein interaction network of SQLE, including:

    • Components of the ubiquitin-proteasome system (especially MARCHF6)

    • Regulators like SPF and SPF2

    • Potential novel interacting partners

  • Translational Research: Leveraging insights from rat SQLE to develop:

    • Novel cholesterol-lowering approaches

    • Cancer therapies targeting SQLE

    • Diagnostic markers based on SQLE activity or truncation

  • Integration with Systems Biology: Placing SQLE within broader metabolic networks to understand how its regulation coordinates with other aspects of lipid metabolism under various physiological and pathological conditions.

Addressing these challenges will require interdisciplinary approaches combining advanced molecular biology techniques, structural biology, lipidomics, and translational research methodologies.

Table 1: Comparison of Properties Between Recombinant and Native Rat SQLE

PropertyRecombinant Rat SQLE (rSE)Rat Liver Microsomal SQLENotes
Molecular WeightVariable depending on N-terminal truncationFull-length native proteinRecombinant version typically lacks 99 N-terminal amino acids
Cofactor RequirementsFAD, NADPH, NADPH-cytochrome c reductaseFAD, NADPH, NADPH-cytochrome c reductaseBoth forms show similar cofactor dependencies
Detergent RequirementS105 fraction or Triton X-100Membrane environmentBoth require hydrophobic environment for activity
pH DependencySimilar to microsomal enzymeCharacteristic profilepH optima match between recombinant and native forms
Inhibitor SensitivitySensitive to NB-598Sensitive to NB-598Similar pharmacological responses
Products Formed2,3-Oxidosqualene (OSQ) and 2,3;22,23-dioxidosqualene (DOSQ)2,3-Oxidosqualene (OSQ) and 2,3;22,23-dioxidosqualene (DOSQ)Both catalyze identical reactions
Purification Yield~50% from E. coli extractVariable from tissue100-fold purification achieved for recombinant version
SPF StimulationResponsive to SPFResponsive to SPFBoth forms show enhanced activity with SPF

Table 2: Factors Affecting Rat SQLE Activity and Regulation

FactorEffect on SQLEMechanismReference
Supernatant Protein Factor (SPF)StimulationPromotes intermembrane transfer of squalene
SPF2Stimulation (half as effective as SPF)Similar to SPF but more strongly inhibited by GTP/GDP
Protein Kinase AEnhanced activityPhosphorylation of SPF/SPF2 increases stimulatory effect
GTP/GDPInhibitionInhibits SPF2-mediated stimulation
Alpha-tocopherolPrevention of inhibitionPrevents GTP/GDP inhibition of SPF2
HypoxiaPromotes truncationInduces squalene accumulation
SqualenePromotes truncation, Inhibits degradationActs via N-terminal regulatory domain
CholesterolAccelerates degradationEnhances ubiquitination via N-terminal domain
NB-598 (inhibitor)Inhibits activity, Induces truncationBinds and stabilizes catalytic domain

Table 3: SQLE Truncation Inducers and Their Mechanisms

InducerEffect on SQLEDomain InvolvedOutcomeReference
HypoxiaPromotes truncationIndirect effect via squalene accumulationForms constitutively active trunSM
SqualenePromotes truncationN-terminal regulatory domain (SM-N100)Truncated enzyme resistant to cholesterol inhibition
MonooxidosqualenePromotes truncationSimilar to squaleneSimilar to squalene
DioxidosqualenePromotes truncationSimilar to squaleneSimilar to squalene
NB-598Induces truncationCatalytic domainStabilizes catalytic domain
SqualaneNo effect on truncationN/ADemonstrates specificity of squalene effect

What are common issues in recombinant rat SQLE expression and how can they be resolved?

Researchers working with recombinant rat SQLE may encounter several challenges during expression and purification. Below are common issues and their solutions:

Low Expression Levels:

  • Problem: Full-length SQLE often expresses poorly in E. coli due to its membrane-association and regulatory domains.
    Solution: Delete nucleotides coding for 99 amino acids in the N-terminal region while adding a hexa-histidine tag at the C-terminal end, as this modified construct facilitates efficient expression in E. coli .

  • Problem: Toxicity to host cells during expression.
    Solution: Use tightly controlled inducible promoters, lower induction temperatures (16-20°C), and shorter induction times to reduce toxicity while maintaining yield.

Protein Insolubility:

  • Problem: Aggregation and inclusion body formation.
    Solution: Expression at lower temperatures, co-expression with chaperones, or use of solubility tags (e.g., MBP, SUMO) in addition to the His-tag.

  • Problem: Membrane association leading to poor solubility.
    Solution: Include appropriate detergents (e.g., Triton X-100) during cell lysis and purification steps .

Purification Challenges:

  • Problem: Non-specific binding during affinity chromatography.
    Solution: Optimize imidazole concentrations in binding and washing buffers for Ni-chelate affinity purification. Include a secondary purification step like Cibacron Blue Sepharose chromatography .

  • Problem: Low yield after purification.
    Solution: Optimize each purification step individually, ensure proper buffer conditions, and minimize the number of steps to reduce losses. The documented protocol achieves approximately 50% yield .

Activity Loss:

  • Problem: Loss of enzymatic activity during or after purification.
    Solution: Include stabilizing agents (glycerol, reducing agents), perform purification at 4°C, and minimize freeze-thaw cycles. The reconstituted assay system should include appropriate cofactors (FAD, NADPH), NADPH-cytochrome c reductase, and a proper lipid environment .

  • Problem: Variable activity measurements.
    Solution: Standardize assay conditions carefully, including cofactor concentrations, pH, and detection methods. Compare activity with rat liver microsomal SQLE as a benchmark .

How can researchers optimize assay conditions for specific aspects of SQLE research?

Optimizing assay conditions for specific aspects of SQLE research requires tailored approaches:

For Basic Enzymatic Activity Studies:

  • Buffer Optimization: Test multiple buffer systems (phosphate, Tris, HEPES) at different pH values to determine optimal conditions that match native enzyme behavior .

  • Cofactor Titration: Systematically vary concentrations of NADPH and FAD to determine optimal levels that prevent these components from being rate-limiting.

  • Detergent Selection: Evaluate different detergents besides Triton X-100 (e.g., digitonin, CHAPS, DDM) at various concentrations to find the optimal micelle environment that mimics the native membrane.

For Regulation and Truncation Studies:

  • Hypoxia Conditions: When studying hypoxia-induced truncation, carefully control oxygen levels. Use different oxygen concentrations (1%, 2%, 5%) and exposure times to establish dose-response relationships .

  • Substrate Delivery: For studies involving squalene effects, optimize delivery methods using appropriate carriers or solvents that ensure consistent cellular uptake without toxicity.

  • Time-Course Analysis: Implement detailed time-course experiments to capture the kinetics of truncation and response to regulatory factors.

For Inhibitor Studies:

  • Compound Solubility: Ensure proper solubilization of inhibitors like NB-598 in appropriate vehicles that don't interfere with the assay.

  • Pre-incubation Protocols: Determine optimal pre-incubation times for inhibitors to achieve equilibrium binding before initiating the reaction.

  • IC50 Determination: Use a wide concentration range with multiple replicates to generate reliable dose-response curves for accurate IC50 calculation.

For SPF/SPF2 Stimulation Studies:

  • Protein Purity: Ensure high purity of SPF/SPF2 preparations to avoid confounding effects from contaminants.

  • Stoichiometry Optimization: Titrate SPF:SQLE ratios to determine the optimal stoichiometry for maximum stimulation .

  • Phosphorylation Conditions: When studying phosphorylation effects, optimize protein kinase A concentrations and incubation conditions to achieve consistent phosphorylation status .

Data Analysis Optimization:

What considerations are important when translating findings from rat to human SQLE research?

When translating findings from rat to human SQLE research, several important considerations must be addressed:

Structural and Functional Conservation:

  • Sequence Homology Analysis: Thoroughly analyze sequence conservation between rat and human SQLE, particularly in key functional domains and residues identified in mechanistic studies. This helps predict which findings are likely to translate directly.

  • Domain-Specific Differences: Pay particular attention to any differences in the N-terminal regulatory domain, as this region mediates critical regulatory functions that could vary between species .

  • Post-translational Modifications: Compare known or predicted post-translational modification sites between rat and human SQLE, as these could affect regulation, activity, and drug responses.

Experimental Design Considerations:

  • Parallel Testing: When possible, conduct key experiments with both rat and human SQLE in parallel to directly compare responses under identical conditions.

  • Expression Systems: Consider that heterologous expression systems may affect rat and human proteins differently. For example, codon optimization requirements might differ when expressing in E. coli .

  • Cellular Context: Account for potential differences in cellular environments, including membrane composition, protein interaction partners, and regulatory pathways between rat and human cells.

Regulatory and Physiological Context:

  • Tissue-Specific Expression: Consider differences in tissue-specific expression patterns. For example, SPF2 appears to be predominantly expressed in respiratory and epithelial tissues in rats, whereas SPF is expressed in liver . Such differences could affect the physiological relevance of findings.

  • Metabolic Rates: Account for differences in basal metabolic rates and cholesterol homeostasis between rats and humans when interpreting effects on lipid metabolism.

  • Pharmacological Responses: While both rat and human SQLE respond to inhibitors like NB-598, differences in binding affinity, metabolism, or off-target effects may exist .

Translational Research Applications:

  • Disease Relevance: Consider whether the disease states being modeled (e.g., hyperlipidemia, cancer) manifest similarly in rats and humans.

  • Drug Development Pipeline: Recognize that findings in rat models require validation in human systems before clinical applications. The availability of human SQLE structural data can guide rational drug design approaches .

  • Biomarker Potential: When identifying potential biomarkers based on SQLE activity or truncation, verify that the same markers are relevant and detectable in human samples.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.