Recombinant Rat Stannin (Snn)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Stannin (Snn)

Recombinant Rat Stannin (Snn) is a synthetic protein produced through bacterial expression systems, primarily E. coli, and is engineered with an N-terminal His-tag for purification and functional studies. As a highly conserved vertebrate protein, Snn (UniProt ID: P61808) spans 88 amino acids and plays roles in cellular responses to stressors, including oxidative stress and toxicant exposure .

Biochemical Properties of Recombinant Rat Stannin (Snn)

Table 1: Key Biochemical Characteristics

PropertyDetailsSource
Amino Acid SequenceMSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG
Molecular Weight~10 kDa (estimated for full-length protein)
Expression SystemE. coli
Purification TagN-terminal His-tag
Purity>90% (SDS-PAGE confirmed)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)

Table 2: Primary Experimental Uses

ApplicationDescriptionSource
SDS-PAGEQuality control for protein purity and confirmation of molecular weight.
TNF-α Signaling StudiesInvestigating Snn’s role in TNF-α-induced growth arrest in endothelial cells.
Toxicity MechanismsStudying interactions with environmental toxins (e.g., arsenic, paracetamol).

Key Research Findings

  1. TNF-α-Induced Expression:

    • Snn mRNA is upregulated in human umbilical vein endothelial cells (HUVECs) following TNF-α treatment, mediated by PKC-ε .

    • siRNA knockdown of Snn exacerbates TNF-α-induced growth inhibition, indicating a regulatory role in cell cycle control .

  2. Chemical Interactions:

    • Snn expression is modulated by environmental toxins and drugs:

      • Arsenic compounds: Increase Snn mRNA in rat models .

      • Paracetamol: Elevates Snn expression, suggesting a role in hepatotoxicity .

      • Valproic acid: Alters Snn mRNA levels, linking to neurotoxic effects .

Functional Insights from Comparative Studies

Table 3: Cross-Species Conservation and Functional Implications

SpeciesSequence IdentityFunctional RelevanceSource
Rat100% (Mouse)Shared role in toxicant response and cell survival.
Human99% (Rat)C-terminal divergence may influence species-specific interactions.
ZebrafishN/ARecombinant SNN available for evolutionary studies.

Mechanistic Hypotheses

  • Membrane Localization: The GCWC motif suggests potential interaction with membrane-bound proteins or lipids .

  • Stress Response: Snn’s induction by TNF-α and toxins implies a protective or regulatory function in cellular stress adaptation .

Challenges and Future Directions

Critical Knowledge Gaps

  • Exact Molecular Mechanism: Direct binding partners and signaling pathways remain undefined.

  • In Vivo Relevance: Most studies focus on in vitro models; translational research is needed.

Proposed Research Avenues

  1. Structural Characterization: NMR/X-ray crystallography to resolve Snn’s tertiary structure.

  2. Toxicity Biomarkers: Investigating Snn as a biomarker for arsenic or drug-induced toxicity.

  3. Therapeutic Applications: Exploring Snn-targeted interventions in inflammation or neurodegenerative diseases.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Snn; Stannin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-88
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Snn
Target Protein Sequence
MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTANSPEVHG
Uniprot No.

Target Background

Function
Stannin plays a role in the toxic effects of organotins and in endosomal maturation.
Gene References Into Functions
  1. Stannin modulates MAPK signaling pathways through interactions with 14-3-3zeta. PMID: 15923056
Database Links

KEGG: rno:29140

STRING: 10116.ENSRNOP00000003333

UniGene: Rn.6147

Protein Families
Stannin family
Subcellular Location
Mitochondrion outer membrane; Single-pass membrane protein.
Tissue Specificity
High level of expression in spleen, followed by brain and kidney.

Q&A

Basic Research Questions

  • What is Rat Stannin and what are its key structural features?

Stannin (Snn) is an 88-amino acid protein that is highly conserved throughout vertebrate evolution . The rat Stannin sequence includes specific amino acid regions such as "CWCYLRLQR ISQSEDEESI VGDGETKEPF LLVQYSAKGP CVERKAKLMT ANSPEVHG," which represents amino acids 32-88 of the protein .

As a research methodology, structural analysis of Stannin typically employs techniques such as circular dichroism spectroscopy and NMR to determine secondary structure elements. When working with recombinant fragments, researchers should consider how the selected region (such as AA 32-88) might affect protein folding and functional capacity compared to the full-length protein.

  • How conserved is Stannin across species and what does this suggest about its function?

Stannin demonstrates remarkable evolutionary conservation, suggesting essential biological roles. The rat and mouse Snn amino acid sequences are 100% identical, while the human Snn differs by only two amino acids at the C-terminus . At the nucleotide level, human and mouse Snn sequences share 90% identity .

This high degree of conservation can be investigated through comparative genomics approaches:

  • Multiple sequence alignment of Snn from different species

  • Phylogenetic analysis to establish evolutionary relationships

  • Identification of conserved domains that may indicate functional regions

  • Mutational analysis of conserved residues to determine their importance

The strong conservation suggests that Stannin plays fundamental roles in cellular processes that have been maintained through evolutionary pressure.

  • What expression systems are used for producing recombinant Rat Stannin?

Several expression systems have been utilized for recombinant Rat Stannin production:

Expression SystemProtein RegionTagPurityApplicationsNotes
YeastAA 32-88His tag>90%ELISAPartial protein
HEK-293 CellsAA 1-88Fc Tag>90%ELISA, Western Blot, analytical SECFull-length protein with mammalian processing

When selecting an expression system, researchers should consider:

  • Required post-translational modifications

  • Need for proper protein folding

  • Downstream applications (structural studies, functional assays)

  • Scale of production needed

For functional studies, mammalian expression systems may offer advantages for proper folding and modifications, though microbial systems can provide higher yields for structural studies.

  • What purification methods are most effective for recombinant Rat Stannin?

Effective purification of recombinant Rat Stannin typically follows a multi-step approach:

  • Affinity chromatography using the fusion tag (e.g., His-tag, Fc-tag)

  • Size exclusion chromatography for further purification

  • Quality assessment using techniques such as:

    • SDS-PAGE (Bis-Tris PAGE for Fc-tagged variants)

    • Western Blot with anti-tag antibodies

    • ELISA

    • Analytical SEC (HPLC)

Researchers should optimize buffer conditions to maintain protein stability, potentially including reducing agents if the sequence contains cysteine residues (as seen in the "CWCYLRLQR..." sequence) . Purity levels exceeding 90% are achievable and recommended for most research applications .

Advanced Research Questions

  • What is the role of Stannin in TNF-α signaling pathways?

Stannin plays a significant role in tumor necrosis factor-α (TNF-α) signaling pathways. Research has demonstrated that Snn mRNA expression is induced by TNF-α treatment in a protein kinase C-ε (PKC-ε)-dependent manner in human umbilical vein endothelial cells (HUVECs) .

Methodologically, this relationship can be investigated by:

  • Treating cells with TNF-α and measuring Snn expression through quantitative RT-PCR

  • Using PKC-ε inhibitors to confirm the dependency of the signaling pathway

  • Performing Snn knockdown via siRNA prior to TNF-α treatment

  • Analyzing downstream effects on cell growth and gene expression profiles

Experimental evidence shows that Snn knockdown prior to TNF-α treatment results in significant inhibition of HUVEC growth compared to TNF-α treatment alone, suggesting Stannin mediates certain cellular responses to TNF-α .

  • How does Stannin knockdown affect cell cycle regulation?

Microarray analysis of TNF-α-stimulated HUVECs with and without Snn knockdown has revealed significant impacts on cell cycle regulation .

Key findings include:

  • Cell growth and maintenance genes represent 33% of significantly altered genes

  • Signal transduction genes account for 18.75% of altered genes

  • Nucleic acid metabolism genes make up 17.7% of altered genes

Specifically affected genes include IL-4, p29, PRKC/WT1, MDM4, PLA2, E-selectin, cdc42 binding protein, and human Ras-like suppressor, with IL-4, p29, and MDM4 having direct implications for cell cycle regulation .

For methodological investigation, researchers should:

  • Design specific siRNA targeting Snn with appropriate controls

  • Validate knockdown efficiency using qRT-PCR and Western blot

  • Perform microarray analysis or RNA-seq to identify affected pathways

  • Validate key targets using qRT-PCR

  • Assess functional outcomes through cell proliferation assays, cell cycle analysis, and apoptosis measurements

  • What experimental approaches are most effective for studying Stannin function using recombinant protein?

Several experimental approaches have proven effective for studying Stannin function:

  • Recombinant protein production strategies:

    • Expression of different domains (full-length vs. AA 32-88)

    • Comparison of different tags (His vs. Fc) for functional impact

    • Mammalian vs. yeast expression systems for proper folding

  • Functional characterization assays:

    • Binding assays to identify interaction partners

    • Cell-based assays using purified recombinant protein

    • In vitro enzymatic activity measurements if applicable

  • Structural studies:

    • Circular dichroism for secondary structure analysis

    • NMR or X-ray crystallography for detailed structural information

    • Mutation analysis of conserved residues

  • Complementation studies:

    • Rescue experiments in Snn-knockdown cells using recombinant protein

    • Structure-function relationship studies using domain deletions or point mutations

  • What is known about Stannin's role in trimethyltin (TMT) toxicity and how can recombinant protein aid research?

Stannin has been demonstrated to be necessary, but not sufficient, for trimethyltin (TMT) toxicity . This relationship provides an important research avenue for toxicology studies.

Methodological approaches to investigate this role using recombinant Stannin include:

  • Binding assays between recombinant Stannin and TMT

  • Structure-function studies using various Stannin mutants

  • Cell-based toxicity assays comparing wild-type and Snn-deficient cells

  • Rescue experiments introducing recombinant Stannin into Snn-knockout cells

  • Comparative analysis of TMT binding to Stannin from different species

Understanding the molecular basis of this interaction could provide insights into mechanisms of metal toxicity and potential therapeutic interventions.

  • How can microarray analysis be effectively applied to understand Stannin's cellular functions?

Microarray analysis has been successfully employed to elucidate Stannin's role in cellular functions, particularly in relation to TNF-α signaling . A methodological framework for such analysis includes:

  • Experimental design:

    • Establish appropriate Snn knockdown using validated siRNA

    • Include proper controls (scrambled siRNA)

    • Design appropriate treatment conditions (e.g., with/without TNF-α)

  • Data analysis approach:

    • Apply statistical methods like one-way ANOVA with appropriate cutoff p-values (p < 0.001)

    • Filter results to focus on genes with significant fold changes (≥2.5-fold)

    • Validate key findings using quantitative RT-PCR

  • Functional categorization:

    • Group affected genes by biological process (cell growth, signal transduction, etc.)

    • Perform pathway analysis to identify networks affected by Snn modulation

    • Validate key nodes in identified pathways through targeted experiments

This approach has successfully identified that Snn knockdown affects genes involved in cell growth and maintenance (33%), signal transduction (18.75%), and nucleic acid metabolism (17.7%) .

  • What are the challenges in evaluating the biological activity of recombinant versus native Stannin?

Evaluating biological equivalence between recombinant and native Stannin presents several methodological challenges:

  • Structural integrity verification:

    • Comparison of secondary/tertiary structure

    • Analysis of post-translational modifications

    • Assessment of oligomerization state

  • Functional equivalence testing:

    • TNF-α response modulation capacity

    • Cell growth effects

    • Trimethyltin toxicity mediation

  • Technical considerations:

    • Ensuring proper folding of recombinant protein (especially from bacterial systems)

    • Addressing potential effects of fusion tags on function

    • Developing relevant quantitative assays for functional comparison

  • Validation approaches:

    • Complementation studies in Snn-deficient systems

    • Competitive binding assays

    • Comparative proteomics to identify differential binding partners

Researchers must carefully consider these factors when designing experiments using recombinant Stannin to ensure biological relevance of their findings.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.