Recombinant Rat Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (Nsdhl)

Shipped with Ice Packs
In Stock

Description

Biochemical Properties and Production

Recombinant Nsdhl is a full-length protein (1–362 amino acids) with an N-terminal His-tag for purification and detection. Key specifications include:

ParameterDetails
SourceE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
Molecular Weight~42 kDa (observed), ~40 kDa (calculated)
Storage-20°C/-80°C (lyophilized); reconstitute in sterile water/glycerol

This enzyme catalyzes the oxidative decarboxylation of 4α-carboxysterols, removing two C-4 methyl groups during cholesterol synthesis . Its dual localization in the endoplasmic reticulum (ER) and lipid droplets suggests roles in both sterol metabolism and lipid storage .

Enzyme Activity and Inhibitor Screening

Recombinant Nsdhl is pivotal for studying cholesterol pathway inhibitors. For example:

  • FR171456, a natural product, inhibits Nsdhl with an IC₅₀ of 6.3 nM, blocking cholesterol synthesis and enhancing antitumor effects in EGFR-driven cancers .

  • Compound 9 (IC₅₀ ≈ 8 μM) disrupts EGFR signaling by altering cholesterol turnover, sensitizing cancer cells to kinase inhibitors .

Lipid Droplet Dynamics

Nsdhl associates with ER-derived lipid droplets, suggesting a role in regulating neutral lipid storage and cholesterol distribution . Recombinant Nsdhl is used to study lipid droplet biogenesis in metabolic disorders.

Key Features of Recombinant Nsdhl

FeatureDetails
Active SiteContains conserved lysine/glutamic acid residues critical for decarboxylation .
Coenzyme BindingRequires NAD⁺/NADP⁺ for catalytic activity; structural flexibility observed upon binding .
Subcellular LocalizationER membranes and lipid droplets, mediated by Golgi trafficking .

Mechanistic Implications

  • Cholesterol synthesis: Nsdhl deficiency leads to methylsterol accumulation, impairing Hedgehog signaling and causing cerebellar defects in mice .

  • Cancer biology: Inhibiting Nsdhl reduces cholesterol availability, sensitizing cells to EGFR inhibitors .

Inhibitor Screening Platforms

Recombinant Nsdhl enables high-throughput screening for sterol pathway inhibitors. Notable findings:

  • FR171456: Targets Nsdhl in yeast and mammals, validated via metabolomics and enzymatic assays .

  • Compound 9: Blocks Nsdhl activity, reduces EGFR protein stability, and synergizes with erlotinib in cancer models .

Comparative Analysis of Inhibitors

InhibitorTargetMechanismApplication
FR171456Nsdhl/Erg26pCompetitive inhibitionCholesterol-lowering, antifungal
Compound 9NsdhlAllosteric modulationEGFR-driven cancer therapy

Disease Associations

  • CHILD syndrome: X-linked mutations in NSDHL cause lethal cholesterol defects in males .

  • CK syndrome: Hypomorphic NSDHL mutations lead to intellectual disability and cerebral malformations .

Therapeutic Potential

  • Cancer treatment: Nsdhl inhibitors enhance EGFR-targeted therapies by depleting cholesterol, a critical membrane component .

  • Metabolic disorders: Modulating Nsdhl activity may restore cholesterol homeostasis in CHILD/CK syndrome .

Future Directions

  1. Structural optimization of inhibitors targeting Nsdhl’s coenzyme-binding site .

  2. Gene therapy approaches to correct NSDHL mutations in genetic disorders .

  3. Biomarker development for monitoring cholesterol-related diseases using recombinant Nsdhl assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference for your consideration.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nsdhl; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Nsdhl
Target Protein Sequence
MEQAVRSESKKGQVTGTDLINEVSKAKKCTVIGGSGFLGQHMVEQLLSRGYAVNVFDVRQ GFDNPRVQFFIGDLCNQQDLYPALKGVSTVFHCASPPSNSNNKELFYRVNSTGTKTVIET CKEAGVQKLILTSSASVVFEGVDIKNGTEDLPYAMKPIDYYTETKILQERAVLDANDPKK NFLTAAIRPHGIFGPRDPQLVPVLIDAARKGKMKFMIGNGKNLVDFTFVENVVHGHILAA EHLSRDAGLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYRVAYYLAFLLSLLV MVLSPLIQIQTTFTPFRVALAGTFHYYSCEKAKKLIGYRPLVTMDDAVERTVQSFHHLRK DK
Uniprot No.

Target Background

Function

This recombinant rat Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating (Nsdhl) catalyzes the NAD(P)(+)-dependent oxidative decarboxylation of the C4 methyl groups of 4-alpha-carboxysterols within the post-squalene cholesterol biosynthesis pathway. It also plays a regulatory role in EGFR endocytic trafficking.

Database Links
Protein Families
3-beta-HSD family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Lipid droplet.

Q&A

What is NSDHL and what role does it play in cholesterol biosynthesis?

NSDHL (NAD(P)-dependent steroid dehydrogenase-like) is an enzyme that functions as a sterol-4-alpha-carboxylate 3-dehydrogenase in the cholesterol biosynthesis pathway. It is localized in the endoplasmic reticulum and participates in the conversion of lanosterol to cholesterol, specifically during the C4-demethylation process. NSDHL functions as part of an enzyme complex that removes a carbon atom and three hydrogen atoms (a methyl group) from lanosterol . The C4-demethylation reaction involves three sequential steps: hydroxylation, oxidation to an aldehyde, and oxidative decarboxylation, with NSDHL specifically catalyzing the NAD⁺-dependent oxidative decarboxylation of the C4 methyl groups of 4α-carboxysterols .

How does rat NSDHL compare structurally to human NSDHL?

While the search results primarily discuss human NSDHL, comparative analysis shows that rat NSDHL maintains high sequence homology with human NSDHL. The crystal structures of human NSDHL reveal a detailed description of the coenzyme-binding site and a unique conformational change upon coenzyme binding that is likely conserved in rat NSDHL .

The structural analysis indicates that both human and rat NSDHL contain:

  • NAD(P) binding domains

  • A catalytic domain with the active site

  • Membrane association regions, as NSDHL is localized to the endoplasmic reticulum membrane and lipid droplets

What are typical expression patterns of NSDHL in mammalian tissues?

NSDHL exhibits tissue-specific and developmentally regulated expression patterns. Based on immunohistochemistry studies in mice, which share significant homology with rats:

Tissue/OrganNSDHL Expression LevelDevelopmental Stage
LiverVery highEmbryonic and postnatal
Dorsal root gangliaHighEmbryonic
Central nervous systemHighEmbryonic and postnatal
RetinaHighEmbryonic
Adrenal glandVery highEmbryonic
Testis (Leydig cells)Very highEmbryonic
Cerebral cortexHighPostnatal
Hippocampal neuronsHighPostnatal
Metanephric glomeruliModerateEmbryonic
Intestinal epitheliumModerateEmbryonic

Notably, NSDHL expression is not necessarily correlated with cell proliferation but is often associated with specific differentiated cell types .

What expression systems are most effective for producing recombinant rat NSDHL?

For optimal expression of enzymatically active recombinant rat NSDHL:

Recommended expression systems:

  • E. coli-based expression: Using BL21(DE3) or Rosetta strains with N-terminal truncation to improve solubility (removing the first 26-32 amino acids that contain the membrane-binding domain)

  • Insect cell expression systems: Using Sf9 or High Five cells with baculovirus vectors for better post-translational modifications

  • Mammalian expression systems: HEK293 or CHO cells for studies requiring native folding and post-translational modifications

The optimization of expression conditions should include:

  • Induction at lower temperatures (16-18°C) for E. coli systems

  • Addition of detergents or lipids during purification to maintain stability

  • Use of affinity tags (His-tag, GST) positioned at the C-terminus to avoid interference with enzymatic activity

What are validated assays for measuring rat NSDHL enzymatic activity?

Multiple complementary approaches can be used to assess NSDHL activity:

  • Reconstitution assay system:

    • Incubation of purified NSDHL (3 μM) with cytochrome P450 reductase (12 μM)

    • Substrate: 30 μM lanosterol

    • Cofactor: 1 mM NADPH

    • Buffer: 50 mM potassium phosphate (pH 7.4) with 50 μg/mL phospholipids

    • Incubation at 37°C for 1-2 hours

  • LC-MS/MS analysis of metabolites:

    • Extraction of sterols from reaction mixture

    • Detection of C4-oxidation metabolites of lanosterol

    • Quantification of reaction intermediates and end products

  • Spectrophotometric assays:

    • Monitoring NAD(P)H oxidation at 340 nm

    • Calculation of initial reaction rates at varying substrate concentrations

How can inhibition studies of NSDHL be properly designed and executed?

When designing inhibition studies for rat NSDHL:

  • Establish baseline enzymatic parameters:

    • Determine Km and Vmax values for the substrate

    • Establish proper enzyme concentration within linear range of activity

  • Inhibitor screening approaches:

    • Structure-based virtual screening using crystal structure information

    • Biochemical evaluation of candidate compounds

    • IC50 determination through dose-response curves

  • Characterization of inhibition mechanism:

    • Competitive vs. non-competitive inhibition patterns

    • Dixon plots and Lineweaver-Burk analysis

    • Determination of Ki values

  • Cellular validation:

    • Assessment of cholesterol levels in treated cells

    • Monitoring accumulation of sterol intermediates

    • Analysis of downstream effects on EGFR signaling pathways

How does NSDHL function in cancer biology, particularly in breast cancer models?

NSDHL plays significant roles in cancer biology beyond its enzymatic function in cholesterol biosynthesis:

  • Regulation of breast cancer stem-like cells (BCSCs):

    • NSDHL knockdown suppresses tumor spheroid formation in breast cancer cells

    • NSDHL regulates BCSC populations with CD44+/CD24- and CD49f+/EpCAM+ phenotypes

    • NSDHL-knockdown reduces high ALDH activity in cancer stem cells

    • NSDHL impacts tumor initiation capacity in orthotopic xenograft models

  • Molecular mechanisms:

    • NSDHL modulates TGF-β signaling pathway, with knockdown decreasing secretion of TGF-β1 and TGF-β3

    • NSDHL affects phosphorylation of Smad2/3 and expression of SOX2

    • Positive correlation exists between NSDHL and SOX2 expression in luminal-type breast cancers

Experimental approach for studying NSDHL in cancer models:

  • RNA sequencing to identify transcriptional changes in NSDHL-knockdown spheroids

  • Flow cytometry for analyzing cancer stem cell markers

  • Orthotopic tumor models to assess tumor initiation and growth

What methods are used to investigate NSDHL's role in developmental processes?

Research into NSDHL's developmental roles employs several specialized techniques:

  • Immunohistochemistry for tissue-specific expression:

    • Analysis of embryonic and postnatal tissues

    • Comparison of expression patterns in wild-type and mutant models

    • Quantification of NSDHL-positive vs. negative cells in mosaic females

  • In situ hybridization:

    • Detection of NSDHL mRNA expression using radiolabeled antisense RNA probes

    • Correlation of mRNA expression with protein distribution

  • Mouse models with NSDHL mutations:

    • Bare patches (Bpa) mouse model with X-linked NSDHL mutations

    • Analysis of mosaic expression in heterozygous females due to X-inactivation

    • Investigation of tissue-specific effects and developmental consequences

  • Developmental phenotype analysis:

    • Assessment of embryonic lethality in males

    • Evaluation of skin abnormalities and other phenotypes in heterozygous females

    • Long-term studies showing negative selection against NSDHL-deficient cells

How can cell-based systems be optimized to study NSDHL function in cholesterol homeostasis?

To effectively study NSDHL's role in cholesterol homeostasis:

  • Inducible knockout/knockdown systems:

    • CRISPR-Cas9 gene editing for complete knockout

    • Tetracycline-inducible shRNA for temporal control of knockdown

    • Knock-in of fluorescent reporters to track NSDHL expression and localization

  • Analytical methods for cholesterol pathway assessment:

    • Gas chromatography-mass spectrometry (GC-MS) for sterol profiling

    • Filipin staining for cellular cholesterol distribution

    • Radiolabeled acetate incorporation to measure de novo cholesterol synthesis rates

  • Subcellular localization studies:

    • Immunofluorescence microscopy to visualize NSDHL in the ER and lipid droplets

    • Subcellular fractionation to isolate membrane compartments

    • Live cell imaging with fluorescent protein-tagged NSDHL

  • Rescue experiments:

    • Complementation with wild-type or mutant NSDHL

    • Structure-function analysis with domain swapping or point mutations

    • Cross-species rescue to identify conserved functional domains

How can NSDHL be targeted in disease models like CHILD syndrome?

CHILD syndrome, caused by mutations in the NSDHL gene, provides important insights for disease modeling:

  • Disease-relevant cell models:

    • Patient-derived fibroblasts or induced pluripotent stem cells

    • CRISPR-Cas9 engineered cell lines carrying NSDHL mutations

    • Analysis of cholesterol synthesis intermediates and cellular consequences

  • Animal models of NSDHL deficiency:

    • Bare patches (Bpa) mouse model that mimics aspects of CHILD syndrome

    • Tissue-specific or inducible knockout approaches

    • Evaluation of developmental phenotypes and tissue abnormalities

  • Therapeutic strategies:

    • Topical cholesterol supplementation for skin manifestations

    • Small molecule chaperones to rescue misfolded NSDHL mutants

    • Gene therapy approaches for localized correction

What is the potential of NSDHL as a drug target for cancer therapy?

NSDHL offers promising avenues for therapeutic intervention in cancer:

  • Rational inhibitor design:

    • Structure-based virtual screening using crystal structures

    • Development of inhibitors targeting the active site or coenzyme binding site

    • Optimization of inhibitor specificity and potency

  • Combination therapy approaches:

    • NSDHL inhibitors enhance the antitumor effects of EGFR kinase inhibitors

    • Synergistic effects with other cholesterol pathway inhibitors

    • Potential for targeting cancer stem cell populations

  • Biomarker development:

    • NSDHL expression as a predictive marker for response to targeted therapies

    • Correlation with cancer stem cell markers and treatment resistance

    • Patient stratification based on cholesterol pathway alterations

What techniques are available for studying NSDHL interactions with other proteins in sterol metabolism?

Several complementary approaches can reveal NSDHL's interactome:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation with antibodies against endogenous NSDHL

    • Proximity labeling techniques (BioID, APEX) to identify neighboring proteins

    • Yeast two-hybrid screening for direct interactors

  • Complex purification approaches:

    • Tandem affinity purification of NSDHL-containing complexes

    • Blue native PAGE to preserve native protein complexes

    • Mass spectrometry identification of complex components

  • Functional validation:

    • siRNA knockdown of interaction partners

    • Mutational analysis of interaction domains

    • FRET or BRET assays to monitor interactions in living cells

  • Cholesterol biosynthesis pathway reconstruction:

    • Reconstitution of multi-enzyme complexes in vitro

    • Analysis of substrate channeling between enzymes

    • Computational modeling of protein complex formation

What are emerging technologies that could advance NSDHL research?

Several cutting-edge technologies show promise for NSDHL research:

  • Cryo-EM for structural studies:

    • High-resolution structures of membrane-bound NSDHL

    • Visualization of multi-enzyme complexes in sterol metabolism

    • Conformational dynamics during catalytic cycle

  • Single-cell technologies:

    • Single-cell RNA-seq to reveal cell-specific NSDHL expression patterns

    • Spatial transcriptomics to map expression in tissues

    • CyTOF analysis of protein levels in heterogeneous populations

  • Advanced genome editing:

    • Base editing or prime editing for precise mutation introduction

    • CRISPR interference/activation for tunable gene expression

    • Tissue-specific conditional knockout models

  • Systems biology approaches:

    • Integration of transcriptomics, proteomics, and metabolomics data

    • Network analysis of cholesterol biosynthesis regulation

    • Machine learning to predict functional consequences of mutations

How can contradictory findings in NSDHL research be reconciled through experimental design?

Resolving contradictions in NSDHL research requires careful methodological considerations:

  • Sources of experimental variability:

    • Species-specific differences (human vs. rat vs. mouse)

    • Cell type-dependent effects on NSDHL function

    • Differences between in vitro and in vivo findings

    • Technical variations in enzyme activity assays

  • Standardization approaches:

    • Development of reference materials and protocols

    • Consistent reporting of experimental conditions

    • Cross-validation using multiple complementary techniques

    • Collaborative studies across different laboratories

  • Integrated experimental design:

    • Combining genetic, biochemical, and cellular approaches

    • Analysis of temporal dynamics in NSDHL function

    • Consideration of compensatory mechanisms in knockout models

    • Careful selection of appropriate model systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.