Recombinant Rat Sterol regulatory element-binding protein 1 (Srebf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Srebf1; Srebp1; Sterol regulatory element-binding protein 1; SREBP-1; Adipocyte determination- and differentiation-dependent factor 1; ADD1; Sterol regulatory element-binding transcription factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-480
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
MDELPFGEAALEQALAEVCEMDAALLTDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTG PSSPGASSPESFSSPASLGSSLEAFLGGPKVTPAPLSPPPSAPTAVKMYPSVPPFSPGPG IKEEPVPLTILQPPAPQPSPGTLLPPSFPPPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQ TPSSLPLGSTPGISPTPLHTQVQSSAAQQPPPASAAPRMSTVASQIQQVPVVLQPHFIKA DSLLLTAVKTDTGATMKTAGINTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIH RLAAGGKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKA IDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTP PPSDAGSPSQSSPLSLGSRGSSSGGSDSEPDSPAFEDNQVKAQRLPSHSRGMLDRSRLAL
Uniprot No.

Target Background

Function
Sterol regulatory element-binding protein 1 (SREBP-1) is a key transcription factor regulating genes involved in cholesterol biosynthesis and lipid homeostasis. It exists as a precursor embedded in the endoplasmic reticulum membrane. Low sterol levels trigger processing, releasing the active transcription factor form which translocates to the nucleus. There, it activates transcription of genes crucial for cholesterol biosynthesis and lipid homeostasis. SREBP-1 exhibits dual sequence specificity, binding to both an E-box motif (5'-ATCACGTGA-3') and the sterol regulatory element 1 (SRE-1) (5'-ATCACCCCAC-3'). It regulates promoters of genes involved in cholesterol biosynthesis and the low-density lipoprotein receptor (LDLR) pathway. SREBP-1A, the predominant isoform in most tissues, has weaker transcriptional activity than SREBP-1A, primarily controlling lipogenic gene expression and strongly activating global lipid synthesis in rapidly growing cells. SREBP-1A, expressed in select tissues, displays higher transcriptional activity, stimulating both lipogenic and cholesterogenic gene expression, playing a role in nutritional regulation of fatty acids and triglycerides in lipogenic organs (e.g., liver), and is required for innate immune response in macrophages by regulating lipid metabolism.
Gene References Into Functions
  1. SREBP1c and SREBP2 are transcriptional regulators of the thyroglobulin gene in thyroid cells. PMID: 27321819
  2. PPAR-alpha inhibition (via blueberry juice and probiotics) increased SREBP-1c and PNPLA-3 levels, preventing nonalcoholic steatohepatitis progression by affecting the SREBP-1c/PNPLA-3 pathway through PPAR-alpha. PMID: 28264426
  3. The involvement of SREBP-1c in FASN promoter histone modification. PMID: 28027934
  4. GSK-3-mediated phosphorylation of serine 73 in rat SREBP-1c, leading to destabilization, represents a novel mechanism inhibiting de novo lipid synthesis in the liver. PMID: 26589965
  5. Betahistine may act on hepatic H1 receptors via AMPKalpha-SREBP-1 modulation. PMID: 26218603
  6. A novel regulatory mechanism by which n-3 PUFAs inhibit insulin-induced SREBP-1c. PMID: 26327595
  7. Srebf-1c was increased in the mammary gland, liver, and adipose tissue of rats fed a low-lipid diet compared to those fed an adequate-lipid diet throughout pregnancy and lactation. PMID: 25046614
  8. V-shaped chronological alterations in white adipose tissue (WAT) are regulated via SREBP1c, likely activated by CR duration-dependent modulation of insulin and leptin signaling. PMID: 25616173
  9. Angiotensin II-induced SREBP-1 activation required angiotensin II type I receptor signaling, PI3K/Akt activation, SCAP, and S1P. PMID: 25398788
  10. SREBP-1c activation contributes to skeletal muscle insulin resistance by suppressing Irs-1 transcription. PMID: 24362725
  11. Maternal fructose intake during pregnancy upregulates hepatic SREBP-1c expression in both fetuses and dams, causing maternal hyperglycemia. PMID: 23065593
  12. Raising plasma insulin to postprandial levels increased SREBP-1 mRNA in the livers and epidydimal adipose tissue of rats and in human adipose tissue. PMID: 23913732
  13. H2O2 increased SREBP-1 protein content by enhancing SREBP-1a mRNA translation. PMID: 23583293
  14. SREBPs are novel transcriptional regulators of NIS. PMID: 23542164
  15. Curcumin treatment in diabetic rats increased AMPK phosphorylation, preventing increased renal SREBP-1c expression. PMID: 22898567
  16. CR-associated WAT remodeling, involving SREBP-1-mediated transcriptional activation and suppressed macrophage infiltration, is regulated independently of GH-IGF-1. PMID: 22645024
  17. Leptin's effect on liver fibrosis may involve its Stat3 pathway's modulation of SREBP-1c expression in hepatic stellate cells (HSCs). PMID: 23295202
  18. Exendin-4 inhibits SREBP1c and C/EBPbeta activation, reducing glucolipotoxicity-induced ER stress and beta-cell apoptosis. PMID: 23257266
  19. Elevated hepatic Raldh1 in Zucker fatty rats may lead to excessive retinoic acid production, increasing Srebp-1c expression. PMID: 23028851
  20. FoxO1 inhibits SREBP-1c transcription by modulating multiple transcription factors, at least partly by reducing Sp1 and SREBP-1c activity. PMID: 22511764
  21. Aberrant LXR activation reproduces beta-cell dysfunction in type 2 diabetes, with a central role played by upregulated SREBP1c and its mediated lipotoxicity. PMID: 22415588
  22. EGR1 upregulation paralleled SREBP1c expression and activity in ethanol-fed Long-Evans rats. PMID: 22292946
  23. SREBP1 expression was elevated in type 2 diabetic rats and reduced by early insulin therapy. PMID: 22093779
  24. Orotic acid induces hepatic lipogenesis, predominantly via the AMPK/SREBP-1 pathway. PMID: 21757781
  25. High sterol regulatory element binding protein-1c is associated with non-alcoholic steatohepatitis pathogenesis. PMID: 21986124
  26. The mRNA levels of insulin-induced (Srebp-1c) and insulin-suppressed (Pck1) genes were analyzed in response to insulin, glucagon, and compactin treatments in hepatocytes. PMID: 21731709
  27. GLUT4 expression in response to insulin and fasting/refeeding in adipose tissue and the role of SREBP-1c in GLUT4 regulation were studied. PMID: 16787385
  28. Orotic acid induced fatty infiltration by stimulating TG synthesis through SREBP-1c upregulation and its target genes involved in fatty acid biosynthesis. PMID: 21167679
  29. SREBP-1c and Wnt10b show inverse expression patterns during muscle ontogenesis, regeneration, and satellite cell differentiation. PMID: 20041157
  30. Increased SREBP-1 expression was observed in the liver tissues of aging Fischer 344 rats. PMID: 20615871
  31. Oxidative stress and nonalcoholic fatty liver disease via SREBP-1c. PMID: 19616615
  32. The role of SREBP-1 in regulating renal lipid metabolism and glomerulosclerosis in diabetes mellitus. PMID: 11875060
  33. SREBP-1's role in inducing lipogenic enzyme genes in response to insulin treatment. PMID: 12016216
  34. The IRS-1-PI 3-kinase pathway's essentiality for insulin-induced expression of SREBP-1c and glucokinase genes. PMID: 12031952
  35. SREBP-1c's pivotal role in long-term muscle insulin sensitivity by transducing insulin's positive and negative actions on specific genes. PMID: 12031958
  36. PUFAs suppress the in vivo proteolytic release of sterol regulatory element binding proteins-1 and -2, but the effect on SREBP-2 is transitory. PMID: 12421847
  37. Sterol regulatory element binding protein-1c maturation's potential implication in beta-cell glucolipotoxicity pathogenesis. PMID: 12600983
  38. Acetyl-CoA carboxylase beta expression in liver is regulated transcriptionally by SREBP-1's direct interaction with promoter II. PMID: 12764144
  39. SREBP-1c RNA and SREBP-1 protein levels respond to nutritional status in skeletal muscle. PMID: 12771318
  40. SREBP1c's role in regulating lipogenic enzymes and transport proteins stimulated by keratinocyte growth factor in type II alveolar cells. PMID: 12865412
  41. The temporal relationships and roles of CCAAT/enhancing-binding protein alpha, sterol regulatory element binding protein-1c, and stearoyl-CoA desaturase 1 in fetal rat lung lipogenesis. PMID: 12896875
  42. Sterol regulatory element-binding protein-1 gene expression's role in hepatic lipogenesis with Protein-tyrosine phosphatase 1B. PMID: 12941932
  43. Protein kinase B's role in insulin-dependent induction of sterol regulatory element-binding protein 1 mRNA in hepatocytes. PMID: 14505487
  44. SREBR-1's role in increasing adipose tissue lipogenic potential after repeated dieting. PMID: 14668913
  45. SREBP-1c is unaltered when modest hepatic glucokinase overexpression alters metabolic gene expression. PMID: 14674713
  46. SREBP-1c and Sp1 interact to regulate phosphoenolpyruvate carboxykinase (GTP) gene transcription in the liver. PMID: 14744869
  47. Rats fed soy protein had elevated hepatic SREBP1 mRNA levels and avoided fatty liver development. PMID: 14988441
  48. Skeletal muscle SREBP-1c gene expression is regulated by nutritional status similarly to liver and adipose tissue. PMID: 15001432
  49. ADD1/SREBP1c controls adiponectin gene expression in differentiated adipocytes. PMID: 15037635
  50. SREBP-1c is stimulated by glucose through a Jak/STAT-dependent pathway and is involved in intramuscular lipid accumulation associated with muscle insulin resistance. PMID: 15039461
Database Links
Protein Families
SREBP family
Subcellular Location
[Sterol regulatory element-binding protein 1]: Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle membrane; Multi-pass membrane protein.; [Processed sterol regulatory element-binding protein 1]: Nucleus.
Tissue Specificity
Expressed predominantly in brown adipose tissue.

Q&A

What is Sterol Regulatory Element-Binding Protein 1 and what are its primary isoforms in rats?

Sterol Regulatory Element-Binding Protein 1 (Srebf1) is a transcription factor that belongs to the basic helix-loop-helix-leucine zipper (bHLH-Zip) family. In rats, as in humans, Srebf1 exists in two major isoforms: SREBP-1a and SREBP-1c (the latter also called ADD-1), both encoded by the same gene but transcribed by different promoters . The SREBP-1a isoform is predominantly expressed in the intestine and spleen, while SREBP-1c is mainly expressed in liver, muscle, and adipose tissue . The proteins function as transcription factors that bind to sterol regulatory elements (SREs) in the promoters of target genes involved in lipid metabolism and glucose homeostasis.

The structural organization of rat Srebf1 closely resembles the human ortholog, with the protein initially synthesized as a precursor attached to the nuclear membrane and endoplasmic reticulum. Following proteolytic cleavage, the mature N-terminal fragment translocates to the nucleus where it binds to SRE sequences in target gene promoters .

How does recombinant rat SREBP-1 differ from endogenous SREBP-1?

Recombinant rat SREBP-1 is typically engineered to contain specific domains of the native protein, with researchers often focusing on the transcriptionally active N-terminal fragment (amino acids 1-403) rather than the full-length protein. This approach mimics the physiological activation of SREBP-1, as the N-terminal fragment corresponds to the mature form that enters the nucleus to regulate gene expression after proteolytic processing .

Unlike endogenous SREBP-1, recombinant versions can be designed with mutations that alter functional properties, such as DNA binding capability. For example, researchers have created dominant negative forms of SREBP-1c by introducing an alanine mutation at amino acid 320, which abolishes binding to SREs and E-boxes while still allowing dimerization . Additionally, recombinant SREBP-1 may include epitope tags to facilitate detection and purification, features absent in the endogenous protein.

What are the key regulatory mechanisms that control SREBP-1 activity in rat models?

SREBP-1 activity in rats is regulated through multiple complex mechanisms:

  • Nutritional regulation: Fasting suppresses SREBP-1c expression in the liver, while high carbohydrate meals strongly induce its expression through insulin signaling .

  • Post-translational modifications: The cAMP-PKA pathway negatively modulates SREBP-1 activity through phosphorylation. Specifically, PKA phosphorylates Ser314 in SREBP-1c (corresponding to Ser338 in SREBP-1a), which attenuates DNA binding and transactivation capacity . This mechanism helps explain how fasting or stress conditions, which elevate cAMP levels, reduce lipogenic activity.

  • Proteolytic processing: Similar to human SREBP-1, rat SREBP-1 is synthesized as a precursor that requires proteolytic cleavage for activation. Sterols inhibit this cleavage, thereby reducing mature SREBP-1 levels and decreasing transcriptional activity .

  • Transcriptional regulation: The SREBP-1a promoter contains GC-boxes that bind transcription factors such as Sp1 and EGR-1, with Sp1 enhancing and EGR-1 suppressing transcription .

  • mTORC1 signaling: Insulin activates mTORC1, leading to increased production of SREBP-1c, which facilitates storage of fatty acids as triglycerides .

What are the optimal expression systems for producing recombinant rat SREBP-1 for research applications?

When producing recombinant rat SREBP-1 for research purposes, several expression systems have proven effective, each with distinct advantages depending on the experimental objectives:

Adenoviral Expression Systems: These are particularly effective for delivering SREBP-1 to primary hepatocytes and liver cells with high efficiency (≈90% transduction) . This approach is valuable for studying endogenous gene regulation by SREBP-1 in physiologically relevant cell types without the limitations of transient transfection.

Bacterial Expression Systems: While not mentioned specifically in the provided search results, E. coli systems are commonly used for producing large quantities of the DNA-binding domain of SREBP-1 for structural studies and in vitro DNA binding assays.

Mammalian Cell Expression: For studies requiring proper post-translational modifications, mammalian expression systems such as HEK293 cells have been successfully employed to create stable cell lines expressing active forms of SREBP-1 at controlled levels .

The choice of expression system should be guided by the specific requirements of the experiment:

  • Use adenoviral systems for primary cell studies and in vivo applications

  • Choose mammalian systems for studies on SREBP-1 processing and regulation

  • Select bacterial systems for structural and biochemical analyses requiring large protein quantities

What methodological approaches are most effective for studying SREBP-1 interactions with target DNA sequences?

Several complementary approaches have proven effective for studying SREBP-1 interactions with target DNA sequences:

Chromatin Immunoprecipitation (ChIP):
ChIP assays provide valuable insights into in vivo DNA occupancy of SREBP-1. This approach has successfully demonstrated that SREBP-1 associates with regulatory regions in target gene promoters, such as the phosphoenolpyruvate carboxykinase (PEPCK-C) gene . ChIP is particularly useful for evaluating how modifications to SREBP-1, such as PKA-mediated phosphorylation, affect its interaction with chromatin in living cells .

Electrophoretic Mobility Shift Assay (EMSA):
EMSA has been effectively used to characterize the binding specificity of SREBP-1 to SRE sequences. This technique revealed that SREBP-1a and SREBP-1c bind with low affinity to SREs in the PEPCK-C gene promoter, and that binding can be enhanced by purified upstream stimulatory activity . EMSAs can also identify competition between SREBP-1 and other transcription factors, such as Sp1, for overlapping binding sites .

Site-Directed Mutagenesis and Reporter Assays:
This combinatorial approach has been instrumental in identifying functional SREs in promoters regulated by SREBP-1. By systematically mutating potential binding sites and assessing the impact on promoter activity using luciferase or other reporter assays, researchers have been able to pinpoint critical nucleotides for SREBP-1 binding and function . For example, this approach revealed that a single base pair difference (T versus A) between the SRE in the PEPCK-C gene and the LDL receptor gene dramatically alters the functional outcome of SREBP-1 binding .

How can researchers effectively measure the transcriptional activity of recombinant rat SREBP-1?

Researchers can effectively measure the transcriptional activity of recombinant rat SREBP-1 using several complementary approaches:

Luciferase Reporter Assays:
These assays provide quantitative measurements of SREBP-1 transcriptional activity. By transfecting cells with a construct containing a luciferase gene driven by a promoter with SREBP-1 binding sites, researchers can measure the impact of recombinant SREBP-1 on transcriptional activation. This approach has been used to demonstrate that SREBP-2 is a more potent inducer of certain promoters than SREBP-1a isoforms .

Quantitative RT-PCR Analysis of Target Genes:
This method enables direct assessment of SREBP-1's effect on endogenous target gene expression. For example, adenovirus-mediated expression of SREBP-1c dominant negative forms in rat hepatocytes completely prevented the expression of glucokinase mRNA, demonstrating the necessity of SREBP-1c for glucokinase expression . This approach provides physiologically relevant information about SREBP-1's transcriptional effects.

RNA-Seq Analysis:
While not explicitly mentioned in the provided search results, RNA-Seq offers comprehensive assessment of SREBP-1's impact on the transcriptome, enabling the identification of both direct and indirect target genes.

Rescue Experiments:
A powerful approach involves using dominant negative forms of SREBP-1 to suppress transcription, followed by reintroduction of functional SREBP-1 at increasing concentrations. This method has demonstrated that restoring active SREBP-1c can rescue glucokinase expression in a dose-dependent manner, confirming the specificity of SREBP-1c's transcriptional effects .

How does recombinant rat SREBP-1 influence lipogenesis and glucose metabolism in experimental models?

Recombinant rat SREBP-1, particularly the SREBP-1c isoform, plays crucial roles in coordinating lipogenesis and glucose metabolism:

Lipogenesis Regulation:
SREBP-1c is a key mediator of lipogenic gene expression in the liver. Adenovirus-mediated expression of SREBP-1c(N)-S314D (a phosphomimetic mutant) in HepG2 cells has been shown to retard lipogenesis, demonstrating how post-translational modifications of SREBP-1c can modulate lipid synthesis . SREBP-1c regulates genes required for fatty acid and lipid production, including fatty acid synthase (FAS), stearoyl-CoA desaturase (SCD), and glycerol-3-phosphate acyltransferase (GPAT) .

Glucose Metabolism:
SREBP-1c has been identified as a major mediator of insulin action on glucokinase expression, a key enzyme in glycolysis. Experiments using dominant negative forms of SREBP-1c demonstrated that active SREBP-1c is necessary in the nucleus for glucokinase expression in hepatocytes . This establishes a direct link between SREBP-1c and hepatic glucose utilization. Additionally, SREBP-1 isoforms inhibit transcription of phosphoenolpyruvate carboxykinase (PEPCK-C), a rate-limiting enzyme in gluconeogenesis , thereby suppressing glucose production.

Insulin Signaling Integration:
Recombinant SREBP-1c models have helped establish that insulin stimulates SREBP-1c expression through the liver X receptor (LXR) and mTORC1 pathways . This insulin-stimulated SREBP-1c increases not only lipogenesis but also glycolysis through activation of glucokinase , revealing SREBP-1c as a central node integrating insulin signaling with both glucose and lipid metabolism.

What is the role of SREBP-1 phosphorylation in regulating its activity, and how can this be studied using recombinant proteins?

SREBP-1 phosphorylation plays a critical role in regulating its transcriptional activity, with the cAMP-PKA pathway emerging as a key negative modulator:

PKA Phosphorylation Sites:
Research has identified Ser338 in the N-terminus of SREBP-1a and its counterpart Ser314 in SREBP-1c as PKA phosphorylation sites both in vitro and in cellular contexts . These sites are physiologically relevant for modulating SREBP-1 activity in response to hormonal and metabolic cues.

Functional Consequences of Phosphorylation:
PKA phosphorylation of SREBP-1 attenuates its DNA occupancy and transactivation capacity, as revealed by chromatin immunoprecipitation assays . Conversely, replacing Ser with Ala (S338A in SREBP-1a) increases transactivation, confirming the inhibitory role of this phosphorylation.

Phosphomimetic Mutants and Their Applications:
Recombinant phosphomimetic mutants, such as SREBP-1a(N)-S338D and SREBP-1c(N)-S314D (replacing Ser with Asp to mimic phosphorylation), have proven valuable for studying phosphorylation effects. These mutants decrease DNA binding and retard lipogenesis when expressed in HepG2 cells , providing insight into how cAMP-PKA signaling modulates lipid metabolism through SREBP-1.

Methodological Approaches:
To study SREBP-1 phosphorylation, researchers can:

  • Use in vitro kinase assays with recombinant SREBP-1 fragments to identify phosphorylation sites

  • Create recombinant phosphomimetic (S→D) or phosphodeficient (S→A) mutants to study functional consequences

  • Employ adenoviral delivery of these mutants to cells for assessing effects on endogenous gene expression

  • Utilize chromatin immunoprecipitation to evaluate how phosphorylation affects DNA binding in vivo

This research has established that the cAMP-PKA pathway, by phosphorylating SREBP-1, provides a mechanism for modulating lipid metabolism in liver cells during fasting or stress conditions , connecting hormonal signaling to metabolic gene regulation.

How does SREBP-1 interact with other transcription factors, and what methods are most effective for studying these interactions?

SREBP-1 engages in complex interactions with various transcription factors, which significantly influences its regulatory functions. Several methodologies have proven effective for investigating these interactions:

Co-Immunoprecipitation and Pull-Down Assays:
These techniques can identify physical interactions between SREBP-1 and other transcription factors. While not explicitly mentioned in the search results for rat SREBP-1, these approaches are standard for studying protein-protein interactions.

Competitive DNA Binding Studies:
Electrophoretic mobility shift assays (EMSAs) have revealed that Sp1 and SREBP-1c compete for binding at overlapping sites in the PEPCK-C gene promoter . Specifically, Sp1 binds independently of SREBP-1c but competes with SREBP-1c for binding at the SRE located at -590 of the PEPCK-C promoter . This competition has functional implications, as it affects transcriptional outcomes.

Chromatin Immunoprecipitation (ChIP):
ChIP analysis in rat hepatocytes has demonstrated that both SREBP-1 and Sp1 associate in vivo with regulatory regions corresponding to SREs in the PEPCK-C gene promoter , confirming the physiological relevance of these interactions.

Functional Reporter Assays:
These assays have revealed that Sp1 is essential for SREBP-1a promoter activity, while EGR-1 suppresses the transcription of the human SREBP-1a promoter . The interplay between these factors at GC-boxes containing overlapping binding sites creates a reciprocal regulation mechanism that influences SREBP-1a expression levels.

Mutational Analysis:
Site-directed mutagenesis of binding sites for interacting transcription factors, followed by functional assays, can elucidate the importance of specific interactions. This approach revealed that intact Sp1-binding sites are essential for SREBP-1a promoter activity .

The interaction between SREBP-1c and Sp1 at the PEPCK-C promoter illustrates a mechanism by which insulin might repress gluconeogenesis: insulin induces SREBP-1c production, which then interferes with the stimulatory effect of Sp1 at position -590 of the PEPCK-C promoter . This example highlights how transcription factor interactions contribute to the metabolic regulatory network.

What are the most promising strategies for using recombinant SREBP-1 to investigate metabolic disorders in animal models?

Several promising strategies leverage recombinant SREBP-1 to investigate metabolic disorders in animal models:

Adenoviral-Mediated Expression Systems:
Adenoviral vectors delivering either constitutively active or dominant negative forms of SREBP-1c have proven highly effective for studying metabolic regulation in vivo and in primary hepatocytes. With transduction efficiencies reaching approximately 90% in hepatocytes , this approach allows for precise manipulation of SREBP-1c activity in the liver, the primary site for lipogenesis and glucose metabolism regulation.

Phosphorylation-Resistant Mutants:
Developing animal models expressing SREBP-1c with mutations at PKA phosphorylation sites (such as S314A) could reveal how disrupting the normal regulatory mechanisms affects whole-body metabolism. Since PKA phosphorylation negatively modulates SREBP-1 activity , such phosphorylation-resistant mutants would be expected to enhance lipogenesis even under fasting or stress conditions when PKA activity is normally elevated.

Tissue-Specific Expression Systems:
While the search results focus primarily on liver models, developing recombinant SREBP-1 expression systems targeting other metabolically active tissues (adipose, muscle, pancreatic β-cells) could provide insights into tissue-specific roles in metabolic disorders.

Integration with Metabolic Challenges:
Combining recombinant SREBP-1 expression with dietary challenges (high-fat, high-carbohydrate diets) or hormonal manipulations (insulin resistance models) can reveal how altered SREBP-1 activity contributes to pathological states like non-alcoholic fatty liver disease, insulin resistance, and diabetes.

Interaction with mTORC1 Pathway:
Given that mTORC1 mediates insulin stimulation of SREBP-1c , recombinant SREBP-1c models could be used to investigate how dysregulation of this pathway contributes to metabolic disorders, potentially identifying new therapeutic targets for conditions like insulin resistance and hepatic steatosis.

How can researchers effectively distinguish between the specific functions of SREBP-1a and SREBP-1c in experimental studies?

Isoform-Specific Expression Patterns:
Leveraging the distinct tissue expression patterns of these isoforms provides a natural means of differentiation. SREBP-1a is predominantly expressed in intestine and spleen, while SREBP-1c is mainly expressed in liver, muscle, and adipose tissue . Researchers can focus their studies on tissues where one isoform naturally predominates.

Isoform-Selective Recombinant Constructs:
Developing recombinant constructs that express either SREBP-1a or SREBP-1c under the control of their native promoters maintains physiological regulation patterns. Alternatively, using heterologous promoters allows for controlled expression of each isoform independently of endogenous regulatory mechanisms.

Rescue Experiments in Knockout Models:
A powerful approach involves using SREBP-1 knockout models (either cells or animals) and selectively reintroducing either SREBP-1a or SREBP-1c using recombinant expression systems. This strategy can reveal isoform-specific capabilities in rescuing particular phenotypes or activating specific target genes.

Transcriptional Activity Comparisons:
Direct comparisons of transcriptional potency, such as the observation that SREBP-2 is a more potent inducer than SREBP-1a of specific promoters , can be extended to compare SREBP-1a and SREBP-1c. Reporter assays using promoters of putative target genes can quantify isoform-specific activation potentials.

Target Gene Profiling:
Comprehensive analysis of gene expression changes following selective expression of each isoform can identify isoform-specific target genes. This approach might reveal that SREBP-1a has broader effects due to its stronger activation domain, while SREBP-1c might show more specialized regulation of lipogenic genes.

Response to Regulatory Stimuli:
The differential response to nutritional and hormonal cues—with SREBP-1c being strongly induced by insulin following carbohydrate meals —provides another means of differentiation. Examining how each isoform responds to specific stimuli can highlight their distinct physiological roles.

What are the emerging techniques for studying SREBP-1 regulation in real-time within living cells?

Although the search results don't specifically discuss real-time techniques for studying SREBP-1 regulation in living cells, several emerging approaches can be inferred from current methodologies and advances in cell biology techniques:

Fluorescent Protein Fusions for Live Imaging:
Creating recombinant SREBP-1 fused to fluorescent proteins (like GFP or mCherry) would enable real-time visualization of SREBP-1 processing, nuclear translocation, and degradation in response to various stimuli. This approach could be particularly valuable for studying how quickly SREBP-1 responds to changes in cellular sterol levels or insulin signaling.

FRET-Based Sensors for Conformational Changes:
Förster Resonance Energy Transfer (FRET) sensors incorporating recombinant SREBP-1 constructs could detect conformational changes or protein-protein interactions in real time. For instance, a FRET system could monitor the interaction between SREBP-1 and its escort protein SCAP, revealing how quickly this complex responds to changing sterol levels.

Bimolecular Fluorescence Complementation (BiFC):
BiFC techniques could visualize SREBP-1 interactions with other transcription factors (like Sp1 or EGR-1 ) in living cells. This would provide spatial and temporal information about these interactions, revealing when and where they occur during metabolic regulation.

CRISPR-Based Live-Cell Genomic Reporters:
CRISPR-Cas9 systems modified for imaging could tag endogenous SREBP-1 binding sites in the genome, allowing visualization of SREBP-1 association with target promoters in living cells. This approach could reveal the dynamics of transcription factor binding and dissociation at specific genomic loci.

Optogenetic Control of SREBP-1 Activity:
Engineering light-responsive domains into recombinant SREBP-1 could enable precise spatiotemporal control of its activity. This approach would allow researchers to activate or inactivate SREBP-1 in specific cell populations at defined times, facilitating the study of acute versus chronic effects on metabolism.

Microfluidic Systems for Dynamic Stimulation:
Combining live-cell imaging of recombinant fluorescent SREBP-1 with microfluidic delivery of metabolic stimuli (insulin, sterols, fatty acids) could reveal how SREBP-1 processing and activity respond to changing nutrient environments in real time.

What statistical approaches are most appropriate for analyzing SREBP-1 regulation data from different experimental conditions?

When analyzing SREBP-1 regulation data from different experimental conditions, researchers should consider these statistical approaches:

Analysis of Dose-Response Relationships:
Rescue experiments demonstrating dose-dependent restoration of glucokinase expression by SREBP-1c require appropriate dose-response curve analysis. Nonlinear regression models can quantify the relationship between SREBP-1c levels and target gene expression, establishing EC50 values that reflect the potency of different SREBP-1c variants.

Two-Way ANOVA for Multiple Factor Analysis:
When studying how SREBP-1 activity is affected by multiple factors (e.g., nutritional state and PKA activation), two-way ANOVA with interaction terms is appropriate. This approach can distinguish between main effects of each factor and synergistic/antagonistic interactions, providing insight into how different regulatory pathways converge on SREBP-1.

Repeated Measures Analysis for Time-Course Studies:
For experiments tracking SREBP-1 activity over time (e.g., after insulin stimulation), repeated measures ANOVA or mixed-effects models account for within-subject correlations, improving statistical power and enabling proper analysis of temporal patterns.

Multiple Testing Correction for Genome-Wide Studies:
When analyzing SREBP-1 effects on multiple genes (e.g., via RNA-Seq), corrections for multiple hypothesis testing (such as Benjamini-Hochberg false discovery rate) are essential to control false positives while maintaining statistical power.

Statistical MethodApplicationAdvantage
Nonlinear regressionDose-response analysisQuantifies relationship between SREBP-1 level and effect
Two-way ANOVAMulti-factor experimentsDistinguishes main effects from interactions
Mixed-effects modelsTime-course experimentsAccounts for within-subject correlation over time
FDR correctionGenome-wide expressionControls false positives in multiple comparisons
DensitometryEMSA and ChIP analysisEnables quantitative comparison of binding affinity

How can researchers reconcile conflicting data regarding SREBP-1 function across different experimental models?

Researchers may encounter conflicting data about SREBP-1 function across experimental models. Several strategies can help reconcile these discrepancies:

Standardize Experimental Conditions:
Variations in cell culture conditions, animal models, feeding states, and hormone levels can dramatically affect SREBP-1 function. For instance, the balance between SREBP-1a and SREBP-1c expression varies across cell types and tissues , potentially explaining functional differences observed in different experimental systems.

Consider Post-Translational Modifications:
The functional state of SREBP-1 is heavily influenced by post-translational modifications, particularly phosphorylation. PKA phosphorylation negatively modulates SREBP-1 activity , so differences in PKA activity across experimental models could yield conflicting results. Researchers should assess the phosphorylation status of SREBP-1 when comparing across studies.

Examine Protein-Protein Interactions:
SREBP-1 interacts with various transcription factors, including Sp1 and EGR-1 , which can enhance or suppress its activity depending on the promoter context. Differences in the expression or activity of these interacting partners across models may explain functional variations.

Evaluate Species-Specific Differences:
While the search results focus primarily on rat and human SREBP-1, species-specific differences in SREBP-1 sequence, regulation, or target gene promoters could contribute to conflicting observations between rodent and human studies.

Use Multiple Complementary Methodologies:
The combination of diverse approaches—such as gene knockout, recombinant expression, and ChIP analysis—provides stronger evidence than any single method. For example, the role of SREBP-1c in glucokinase expression was convincingly demonstrated by showing both that dominant negative SREBP-1c blocked expression and that rescue with wild-type SREBP-1c restored it in a dose-dependent manner .

Conduct Meta-Analysis:
Systematic review and meta-analysis of published data on SREBP-1 function can help identify consistent patterns across studies despite methodological variations, revealing which findings are robust and which may be context-dependent.

What are the key considerations when interpreting data from SREBP-1 binding site mutation studies?

When interpreting data from SREBP-1 binding site mutation studies, researchers should consider several critical factors:

Sequence Context and Specificity:
Single nucleotide changes can dramatically alter SREBP-1 binding and functional outcomes. For example, a single base pair difference between the SRE in the PEPCK-C gene promoter and the LDL receptor gene (T versus A) transformed SREBP-1c from an inhibitor to an enhancer of transcription . This highlights the importance of analyzing mutations in their precise sequence context.

Overlapping Binding Sites:
Many SREBP-1 binding sites overlap with binding sites for other transcription factors. In the PEPCK-C promoter, the SRE at -590 overlaps with an Sp1 site on the opposite DNA strand . Mutations may therefore affect binding of multiple factors, complicating interpretation. Researchers should employ techniques like EMSA with specific antibodies to determine which factors are affected by particular mutations.

Mutation Design Considerations:
When designing mutations for SRE analysis, researchers must distinguish between mutations that:

  • Abolish SREBP-1 binding without affecting overlapping sites

  • Enhance SREBP-1 binding (as in the T to A change that converted the PEPCK-C SRE to match the LDL receptor SRE )

  • Affect multiple transcription factor binding sites simultaneously

Correlation Between Binding and Function:
Changes in SREBP-1 binding do not always correlate directly with functional outcomes. For instance, mutating SREs in the PEPCK-C promoter increased both unstimulated and protein kinase A-stimulated transcription , indicating that the functional consequence of SREBP-1 binding can be context-dependent and may involve recruitment of additional co-factors.

  • In vitro binding assays (EMSA) to confirm direct effects on SREBP-1 binding

  • Reporter gene assays to assess functional impact on transcription

  • ChIP analysis to verify altered occupancy in the chromatin context in vivo

  • Gene expression analysis to confirm effects on endogenous target genes

Inter-Species Promoter Differences:
When extrapolating findings between rat and human SREBP-1 studies, researchers must account for potential differences in promoter architecture. While core binding motifs are generally conserved, the arrangement and context of SREs may differ between species, affecting the interpretation of mutation studies.

What are the cutting-edge technologies for producing and purifying recombinant rat SREBP-1 for structural studies?

While the search results don't specifically address cutting-edge technologies for producing and purifying recombinant rat SREBP-1 for structural studies, several advanced approaches can be inferred based on current protein production technologies:

Mammalian Cell-Free Expression Systems:
These systems combine the advantages of prokaryotic expression efficiency with proper eukaryotic post-translational modifications. For SREBP-1, which undergoes complex regulation through phosphorylation , cell-free systems incorporating mammalian lysates could produce properly modified protein for structural studies.

Insect Cell Baculovirus Expression:
Baculovirus-infected insect cells provide a eukaryotic expression system with high yield and proper protein folding. This system is particularly valuable for producing the membrane-bound precursor form of SREBP-1, which requires the appropriate cellular machinery for correct insertion into membranes.

Split-Intein Systems for Difficult Domains:
SREBP-1 contains both hydrophilic (DNA-binding) and hydrophobic (transmembrane) domains, which present challenges for expression and purification. Split-intein approaches allow separate expression of difficult domains with subsequent protein splicing to generate the full-length protein.

Nanodiscs for Membrane-Associated Forms:
To study the full-length precursor form of SREBP-1, which is normally anchored in the endoplasmic reticulum membrane , nanodisc technology can provide a native-like membrane environment while enabling solubility and purification.

Crystallization Chaperones and Fusion Partners:
For structural studies of the DNA-binding domain, fusion with crystallization chaperones like MBP (maltose-binding protein) or innovative approaches like nanobody-assisted crystallization can improve protein stability and crystallization properties.

Cryo-EM Sample Preparation:
Given the challenges in crystallizing membrane proteins and large transcription factor complexes, cryo-electron microscopy (cryo-EM) approaches are increasingly valuable. Specially designed constructs optimized for cryo-EM grid preparation could overcome limitations of traditional crystallography for SREBP-1 structural studies.

How has CRISPR-Cas9 technology advanced our ability to study SREBP-1 function in cellular and animal models?

While CRISPR-Cas9 technology is not specifically mentioned in the search results, this revolutionary genome editing approach has likely transformed SREBP-1 research in several ways:

Precise Genomic Modification of SREBP-1 Loci:
CRISPR-Cas9 enables the introduction of specific mutations in endogenous SREBP-1 genes, allowing researchers to:

  • Create phosphorylation-resistant variants (e.g., S314A in SREBP-1c) to study the functional importance of PKA regulation

  • Introduce mutations that mimic disease-associated polymorphisms

  • Generate specific knockouts of either SREBP-1a or SREBP-1c while leaving the other isoform intact, which was challenging with traditional knockout technologies

Endogenous Tagging for Visualization and Purification:
CRISPR-Cas9 facilitates insertion of fluorescent proteins or epitope tags into the endogenous SREBP-1 locus, enabling:

  • Live-cell imaging of SREBP-1 processing and nuclear translocation under physiological expression levels

  • Chromatin immunoprecipitation with improved specificity

  • Purification of endogenous protein complexes for proteomic analysis of interacting partners

Promoter Modifications for Mechanistic Studies:
CRISPR-based approaches allow precise editing of SRE elements in endogenous promoters, such as:

  • Introduction of the single-nucleotide change that transforms the inhibitory SRE in the PEPCK-C promoter to an activating SRE like that in the LDL receptor promoter

  • Mutation of overlapping binding sites for competing transcription factors like Sp1

  • Creation of reporter systems where endogenous promoters drive fluorescent protein expression

Temporal Control of Gene Expression:
CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) systems provide reversible, targeted control of SREBP-1 expression without permanent genetic changes, allowing:

  • Acute suppression of SREBP-1 to distinguish direct from indirect effects

  • Isoform-specific modulation through promoter-targeted approaches

  • Tissue-specific regulation through appropriately designed guide RNAs and delivery systems

High-Throughput Screening Approaches:
CRISPR-based screens can identify genes that interact with or regulate SREBP-1, potentially revealing:

  • Novel components of the SREBP-1 processing machinery

  • Cofactors required for transcriptional activity

  • Genes that modify sensitivity to insulin or sterol regulation

What innovative analytical techniques are being developed to quantify SREBP-1 binding affinity to different DNA motifs?

While the search results don't explicitly discuss innovative analytical techniques for quantifying SREBP-1 binding affinity, several cutting-edge approaches can be inferred from advances in transcription factor biology:

High-Throughput SELEX-Seq:
Systematic Evolution of Ligands by Exponential Enrichment coupled with next-generation sequencing (SELEX-Seq) enables comprehensive characterization of SREBP-1 binding preferences. This approach could systematically explore how variations in the canonical SRE sequence affect binding affinity, helping explain observations such as the differential binding to SREs in the PEPCK-C versus LDL receptor promoters .

Microscale Thermophoresis (MST):
This technique measures biomolecular interactions based on changes in the movement of molecules along microscopic temperature gradients. MST requires minimal sample amounts and can be performed in solution, making it ideal for quantifying SREBP-1 binding to various DNA motifs under near-physiological conditions.

Surface Plasmon Resonance (SPR) and Bio-Layer Interferometry (BLI):
These label-free, real-time technologies can determine association and dissociation rates (kon and koff) as well as equilibrium binding constants (KD) for SREBP-1 interactions with different DNA sequences. Such kinetic parameters would provide deeper insight into how single nucleotide changes in SREs affect not just binding strength but also binding dynamics.

DNA-Protein Interaction via Quantitative Optical Trapping:
Single-molecule approaches using optical trapping can measure the force required to disrupt SREBP-1-DNA interactions, providing direct physical measurements of binding strength that complement traditional biochemical assays.

In-Nuclear Quantitative Footprinting:
This approach combines traditional DNase footprinting with high-throughput sequencing to quantify transcription factor occupancy across the genome in intact nuclei. For SREBP-1, this could reveal how binding affinity varies across different genomic contexts and how it is affected by competition with factors like Sp1 .

Competitive Binding Microarrays: Custom DNA microarrays containing systematic variations of SRE sequences could be used to perform competitive binding assays, determining relative affinities of SREBP-1 for thousands of sequence variants simultaneously and identifying subtle sequence preferences beyond the core SRE motif.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.