Recombinant Rat Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (Sdhd)

Shipped with Ice Packs
In Stock

Description

Biological Role of SDHD in the Succinate Dehydrogenase Complex

SDHD is one of four subunits (SDHA, SDHB, SDHC, SDHD) of the SDH complex, which links the tricarboxylic acid (TCA) cycle and the electron transport chain (ETC) . Key functions include:

  • Membrane Anchoring: SDHD forms a transmembrane dimer with SDHC, stabilizing the SDH complex within the inner mitochondrial membrane .

  • Ubiquinone Binding: The SDHC/SDHD dimer provides binding sites for ubiquinone (CoQ), enabling electron transfer from SDHB’s iron-sulfur clusters to ubiquinone, reducing it to ubiquinol .

  • Pathological Implications: Mutations in SDHD are linked to tumors such as paragangliomas and gastrointestinal stromal tumors due to pseudohypoxia and epigenetic dysregulation .

Mitochondrial Dysfunction Studies

Recombinant SDHD is used to investigate mitochondrial disorders. For example:

  • Respiration Defects: Sdhb−/− rat models show impaired mitochondrial respiration and ATP production, mimicking human SDH-deficient pathologies .

  • ROS Mechanisms: SDHD’s role in reactive oxygen species (ROS) generation is studied using inhibitors like thenoyltrifluoroacetone (TTFA), which blocks ubiquinone binding .

Cancer Research

  • Pseudohypoxia: Recombinant SDHD aids in analyzing succinate accumulation in SDH-deficient tumors, which stabilizes HIF-1α and promotes angiogenesis .

  • Therapeutic Targets: siRNA knockdown of Sdhd in rat models reduces proliferation in SDH-deficient cells, highlighting its role in tumor survival .

Challenges and Future Directions

  • Expression Limitations: Recombinant SDHD requires co-expression with SDHC for proper membrane integration, complicating in vitro studies .

  • Therapeutic Development: Small-molecule inhibitors targeting the SDHC/SDHD dimer are being explored to modulate ETC activity in cancers .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we understand your specific needs. If you require a particular format, kindly specify it during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. We encourage you to contact your local distributors for specific delivery timeframe.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for a maximum of one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliqouting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Sdhd; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; CII-4; QPs3; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
57-159
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
SGSKAASLHWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVH GDALQKATKAGLLAVSALTFAGLCYFNYHDVGICRAVAMLWKL
Uniprot No.

Target Background

Function
This protein functions as the membrane-anchoring subunit of succinate dehydrogenase (SDH), a key component of complex II in the mitochondrial electron transport chain. It plays a crucial role in transferring electrons from succinate to ubiquinone (coenzyme Q).
Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What rat strains are most appropriate for studying mitochondrial proteins like Sdhd?

Selecting the optimal rat model depends on your specific research questions and experimental design. Sprague Dawley (SD) rats represent one of the most widely used outbred laboratory rat populations and offer significant genetic diversity for association studies . Alternatively, specialized models like the spontaneously hypertensive rat (SHR) or recombinant inbred strains such as HXB/BXH provide more controlled genetic backgrounds that may be advantageous for mechanistic studies .

When investigating mitochondrial proteins specifically, consider that SD rats from Charles River demonstrate greater genetic diversity than those from Harlan, potentially offering more polymorphisms and favorable minor allele frequency profiles for genetic studies . This genetic diversity must be balanced against the need for experimental consistency, particularly when studying proteins involved in energy metabolism.

How do genetic differences between vendor-sourced rat strains impact mitochondrial protein studies?

Genetic differences between commercially available rat strains are surprisingly substantial and can significantly impact experimental outcomes. Research demonstrates that SD rats from different vendors (Harlan vs. Charles River) show dramatic genetic divergence, with FST estimates indicating they are more genetically distinct than major human ancestry groups . Even rats from the same vendor but different breeding facilities show strong population structure .

These genetic variations can potentially influence:

  • Baseline expression levels of mitochondrial proteins

  • Post-translational modification patterns

  • Protein-protein interaction networks

  • Responses to experimental interventions

For rigorous research on mitochondrial proteins like Sdhd, it is essential to document the exact source of your rat models, consider genotyping to characterize genetic background, and maintain consistency in sourcing throughout your experimental timeline.

What genotyping approaches are recommended when working with outbred rats for mitochondrial protein research?

For genetic characterization of outbred rats in mitochondrial research, double-digest genotyping-by-sequencing (ddGBS) represents an effective approach. This method was successfully employed to obtain dense, high-quality genotypes at 291,438 SNPs across 4,061 rats in a large-scale study of SD rats . The ddGBS approach allows researchers to accurately genotype a substantial portion of the genome at reasonable cost.

When designing genotyping strategies:

  • Consider that Charles River SD rats showed 214,309 identifiable SNPs compared to 114,568 in Harlan rats in previous studies

  • Be aware that SNP distribution may be uneven across chromosomes (see Fig 1C in reference)

  • Recognize that while 100,000-1,000,000 SNPs provide good coverage, even difficult genomic regions would be adequately represented with a minimum of 11,500 SNPs for Charles River and 7,000 for Harlan rats (at MAF > 0.01)

This genetic characterization is particularly valuable when attempting to correlate genetic variations with differences in mitochondrial protein expression or function.

What are the optimal isolation methods for functional mitochondrial membrane proteins like Sdhd from rat tissues?

Isolating functional mitochondrial membrane proteins requires careful consideration of membrane solubilization conditions to maintain native structure and activity. For Sdhd, which forms part of Complex II in the inner mitochondrial membrane, a sequential isolation approach is recommended:

  • Initial tissue homogenization in isolation buffer (typically 250mM sucrose, 10mM HEPES, 1mM EGTA, pH 7.4)

  • Differential centrifugation to isolate intact mitochondria (1,000g to remove debris, followed by 10,000g to pellet mitochondria)

  • Membrane solubilization using mild detergents (digitonin or n-dodecyl-β-D-maltoside at 1-2g per g protein)

  • Affinity purification using antibodies against Sdhd or Complex II

For functional studies, enzyme activity assays should be performed at multiple stages of purification to monitor retention of biological activity. Succinate dehydrogenase activity can be measured spectrophotometrically by monitoring the reduction of artificial electron acceptors like dichlorophenolindophenol (DCIP).

How should researchers account for population structure in rat models when studying mitochondrial proteins?

The significant population structure observed in commercially available rat strains necessitates specific strategies to prevent confounding experimental results. When working with outbred rats from different sources or even different facilities within the same vendor, researchers should:

  • Document the precise source of rats (vendor, breeding facility, and even room within facility)

  • Perform basic genotyping to characterize genetic background when possible

  • Implement statistical approaches that account for population structure

  • Consider using linear mixed models that incorporate relatedness matrices derived from genetic data

  • Employ meta-analysis approaches when combining data from multiple sources

A study examining Pavlovian conditioned approach behavior in SD rats successfully addressed population structure by "fitting a linear mixed model that accounted for population structure and using meta-analysis to jointly analyze all cohorts" . Similar approaches should be considered when studying mitochondrial proteins across different rat populations.

What controls are essential when measuring Complex II activity in different rat strains?

When assessing Complex II activity (which includes Sdhd) across different rat strains, several controls are essential to ensure valid comparisons:

  • Genetic background controls: Include rats from the same genetic background but without the experimental manipulation

  • Positive controls: Samples with known Complex II activity levels

  • Negative controls: Samples treated with specific Complex II inhibitors (e.g., malonate, thenoyltrifluoroacetone)

  • Normalization controls: Measure activity of matrix enzymes like citrate synthase to normalize for mitochondrial content

Activity measurements should be conducted under standardized conditions (temperature, pH, substrate concentrations) and normalized appropriately. Data should be presented as both absolute activity and relative to appropriate normalization markers.

When comparing across strains, it may be valuable to measure multiple parameters of mitochondrial function to distinguish between specific effects on Complex II and general differences in mitochondrial content or function.

How do post-translational modifications of Sdhd differ between rat strains and what implications does this have?

Post-translational modifications (PTMs) of mitochondrial proteins like Sdhd can significantly impact their function, stability, and interactions. While strain-specific differences in Sdhd PTMs have not been comprehensively characterized, the substantial genetic divergence between rat strains suggests potential variation in regulatory pathways affecting these modifications.

Key considerations for investigating strain-specific PTMs include:

  • Identification approach: Mass spectrometry-based proteomic analysis with enrichment for specific modifications (phosphorylation, acetylation, etc.)

  • Functional correlation: Relating identified PTMs to enzyme activity measurements

  • Regulatory mechanisms: Investigating strain-specific differences in the enzymes responsible for adding or removing PTMs

  • Physiological significance: Correlating PTM patterns with phenotypic differences between strains

Understanding strain-specific PTM patterns may help explain contradictory results observed when studying Sdhd across different rat models and could identify novel regulatory mechanisms relevant to human disease.

What approaches can resolve contradictory findings from different rat strains in mitochondrial protein research?

When faced with contradictory results from different rat strains, several methodological approaches can help resolve these discrepancies:

  • Genetic characterization: Perform detailed genetic analysis of the specific strains used, focusing on genes encoding mitochondrial proteins and their regulators

  • Cross-strain validation: Test key findings across multiple well-characterized strains

  • Mechanistic investigation: Move beyond observational studies to investigate underlying mechanisms

  • Environmental standardization: Control for environmental factors (diet, housing conditions, stress) that may interact with genetic factors

  • Development of congenic strains: Create congenic strains to test specific genetic loci, as has been done with other traits

The extensive population structure observed in commercially available rats "has important implications for their use in both genetic and non-genetic studies" and highlights the importance of carefully considering genetic background when interpreting experimental results.

How can researchers effectively use recombinant inbred rat strains to study mitochondrial protein function?

Recombinant inbred (RI) strains offer powerful tools for dissecting the genetic basis of mitochondrial protein function. The HXB/BXH RI strain platform, derived from crossing spontaneously hypertensive rat (SHR/Ola) with Brown Norway congenic (BN-Lx), has been described as "a powerful tool for mapping quantitative trait loci (QTL) for complex phenotypes" .

For mitochondrial protein research, RI strains enable:

  • QTL mapping: Identification of genetic loci influencing mitochondrial protein expression or function

  • Genetic correlation: Analysis of relationships between mitochondrial traits and other physiological parameters

  • Mechanistic hypothesis testing: Development of congenic strains to confirm effects of specific genetic loci

  • Systems biology approaches: Integration of genetic, transcriptomic, and proteomic data

The utility of RI strains has been "enhanced with the development of a new framework marker-based map and strain distribution patterns of polymorphic markers" , making them increasingly valuable for mitochondrial research.

What statistical considerations are important when analyzing Sdhd expression or activity across different rat strains?

Analysis of Sdhd expression or activity across different rat strains requires careful statistical approaches to account for genetic and environmental factors:

  • Power analysis: Determine appropriate sample sizes based on expected effect sizes and variability

  • Control for population structure: Implement linear mixed models that account for genetic relatedness

  • Multiple testing correction: Apply appropriate corrections when testing multiple hypotheses

  • Meta-analysis approaches: Use formal meta-analysis methods when combining data from different experiments or sources

  • Covariate adjustment: Consider relevant physiological covariates (body weight, age, etc.)

When designing experiments, the significant genetic divergence between rats from different vendors (FST > 0.4 between Harlan and Charles River SD rats) must be considered in the statistical approach.

How can researchers integrate genomic and proteomic data to better understand strain-specific differences in Sdhd function?

An integrated multi-omics approach offers the most comprehensive understanding of strain-specific differences in Sdhd function:

  • Genomic characterization: Identify strain-specific variants in Sdhd and related genes

  • Transcriptomic analysis: Examine strain differences in expression levels and splicing patterns

  • Proteomic profiling: Characterize protein abundance, post-translational modifications, and protein-protein interactions

  • Metabolomic assessment: Measure metabolites related to succinate dehydrogenase activity

Data integration can be achieved through:

  • Network analysis to identify coordinated changes across multiple levels

  • Machine learning approaches to identify patterns associated with functional outcomes

  • Causal modeling to infer regulatory relationships

This integrative approach can help distinguish primary genetic effects from secondary consequences and identify potential compensatory mechanisms.

What considerations are important when translating findings from rat models to human mitochondrial disease research?

Translating findings from rat models to human mitochondrial disease research requires careful consideration of several factors:

  • Evolutionary conservation: Assess conservation of protein sequence, structure, and function between rat and human Sdhd

  • Regulatory differences: Consider species-specific differences in gene regulation and post-translational modifications

  • Metabolic considerations: Account for differences in metabolic rate and lifespan between rats and humans

  • Genetic background effects: Evaluate how findings might vary across different genetic backgrounds

When possible, key findings should be validated in human samples or cell models. The substantial genetic diversity observed in outbred rat populations (estimated 8.8 million SNPs across vendors) may actually be advantageous for modeling human population diversity, provided population structure is properly accounted for in the experimental design and analysis.

What are the advantages and limitations of ELISA versus other techniques for quantifying mitochondrial proteins in rat samples?

Different analytical techniques offer complementary approaches for quantifying mitochondrial proteins like Sdhd:

TechniqueAdvantagesLimitations
ELISA- High specificity with appropriate antibodies
- Quantitative results
- Relatively high throughput
- Compatible with complex biological samples
- Dependent on antibody quality
- May not distinguish post-translational modifications
- Limited to measuring abundance, not activity
- Potential cross-reactivity issues
Western Blotting- Visual confirmation of protein size
- Can detect some post-translational modifications
- Relatively simple protocol
- Semi-quantitative
- Lower throughput
- Variable reproducibility
Mass Spectrometry- High specificity and sensitivity
- Can identify post-translational modifications
- Can discover protein-protein interactions
- Does not rely on antibodies
- Expensive equipment
- Complex data analysis
- May require protein enrichment
- Lower throughput
Activity Assays- Measures functional protein
- Can detect subtle functional changes
- Physiologically relevant
- May not be specific to single protein
- Affected by sample preparation
- Requires viable samples

ELISA kits have been successfully used for rat mitochondrial proteins like ALDH5A1 , suggesting similar approaches could be developed for Sdhd, particularly for high-throughput screening applications.

What approaches are recommended for studying protein-protein interactions involving Sdhd in different rat strains?

Investigating strain-specific differences in Sdhd protein interactions requires multiple complementary approaches:

  • Co-immunoprecipitation: Using antibodies against Sdhd to pull down interaction partners, followed by mass spectrometry or western blotting

  • Proximity labeling: In vivo expression of Sdhd fused to enzymes like BioID or APEX2 that biotinylate nearby proteins

  • Blue native-PAGE: Separation of intact respiratory complexes to assess Complex II assembly

  • Crosslinking mass spectrometry: Identification of direct binding interfaces between Sdhd and other proteins

  • Yeast two-hybrid or mammalian two-hybrid screening: Systematic screening for potential interaction partners

When comparing interaction networks across strains, it's essential to account for potential differences in expression levels of both Sdhd and its interaction partners. The genetic diversity observed in outbred rat populations may influence these networks through both direct effects on Sdhd and indirect effects on other mitochondrial proteins.

How should researchers design experiments to distinguish between direct genetic effects on Sdhd and secondary consequences?

Distinguishing primary genetic effects from secondary consequences requires careful experimental design:

  • Temporal studies: Track changes in Sdhd expression/function over time to establish causality

  • Genetic manipulation: Use targeted approaches (CRISPR, RNAi) to directly modulate Sdhd and observe consequences

  • Congenic strains: Develop congenic strains to isolate effects of specific genetic loci, similar to approaches used in other studies

  • In vitro reconstitution: Reconstitute Complex II with components from different strains to test direct effects

  • Cross-species validation: Test whether equivalent genetic differences produce similar effects in other species

Additionally, comprehensive phenotyping is essential to distinguish between specific effects on Sdhd/Complex II and broader effects on mitochondrial function or cellular metabolism. The HXB/BXH recombinant inbred strain platform has been used successfully for such detailed phenotyping across multiple physiological systems and could be valuable for mitochondrial studies as well.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.