Recombinant Rat Sulfhydryl oxidase 1 (Qsox1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a particular tag type is required, please specify it in advance to allow for preferential development.
Synonyms
Qsox1; Qscn6; Sox2; Sulfhydryl oxidase 1; rQSOX; rSOx; FAD-dependent sulfhydryl oxidase-2; SOx-2; Quiescin Q6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-750
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Qsox1
Target Protein Sequence
ARLSVLYSSSDPLTLLDADTVRPAVLGSSSAWAVEFFASWCGHCIAFAPTWKELANDVKD WRPALNLAVLDCADETNSAVCREFNIAGFPTVRFFKAFSKNGTGTALPAAGANVQTLRMR LIDALESHRDTWPPACPPLEPAKLKDINEFFTRSKAEYLALIFEREDSYLGREVTLDLSQ FHAVAVRRVLNSESDVVSKFAVTDFPSCYLLLRNGSVSRVPVLVESRPFYTSYLRGLPGL TREAPPTTAAPVTPDKIAPTVWKFADRSKIYMADLESALHYILRVEVGKFSVLEGQRLVA LKKFVAVLAKYFPGQPLVQNFLHSINDWLQKQQKKKIPYSYFKAALDSRKENAVLAEKVN WIGCQGSEPHFRGFPCSLWVLFHFLTVQAHRYSEAHPQEPADGQEVLQAMRSYVQSFFGC RDCANHFEQMAAASMHQVKSPSNAVLWLWTSHNRVNARLSGALSEDPQFPKVQWPPRELC SACHNEVNGQVPLWDLGATLNFLKAHFSPANIVRDPPAPGPASRRGTQDPEASPNLVMDT LKLETGNSVLGHEQAASAASPGATALDVPAGKPEASGPQELNAGLSMGGASPGQGPPEHT EELLRDVQENAQGQQHLSKRDTEALLLPEVNHLQGPLAPRRGGHSPKQLASILEGEPEAL AIQGRRQWLQVLGGGVSFLDISLCVGLYSVSFMGLLAMYTYFRARMRTPKGHVSYPTA
Uniprot No.

Target Background

Function
Recombinant Rat Sulfhydryl oxidase 1 (Qsox1) catalyzes the oxidation of sulfhydryl groups in peptide and protein thiols to disulfides, concurrently reducing oxygen to hydrogen peroxide. It plays a crucial role in disulfide bond formation in various extracellular proteins. In fibroblasts, Qsox1 is essential for proper laminin incorporation into the extracellular matrix, thereby supporting normal cell-cell adhesion and cell migration.
Gene References Into Functions
  1. QSOX1 stimulates VSMC migration and proliferation in vitro and contributes to neointima thickening in balloon-injured rat carotids. PMID: 25766108
  2. RnQSOX1 offers valuable insights into the functional group of the cysteine involved in dithiol/disulfide exchange and provides a framework for analyzing the energetics of electron transfer in the flavin adenine dinucleotide cofactor. PMID: 24888638
  3. At least two transcripts were detected in brain tissue, suggesting tissue-specific mRNA splicing. PMID: 12438924
  4. The molecular cloning of a novel putative brain sulfhydryl oxidase cDNA, rQSOX-L, has been reported. PMID: 16806532
  5. The kinetics of QSOX1 expression suggest a protective role for QSOX1 rather than involvement in apoptosis. PMID: 17927979
Database Links
Protein Families
Quiescin-sulfhydryl oxidase (QSOX) family
Subcellular Location
[Isoform 1]: Golgi apparatus membrane; Single-pass membrane protein. Secreted.; [Isoform 3]: Secreted.
Tissue Specificity
Isoform 3: Detected in seminal vesicle fluid (at protein level). Isoform 1: Detected in brain, hypophysis, heart, testis and the seminal vesicle. Isoform 3: Highly expressed in the seminal vesicles followed by testis, heart, brain, thymus, hypophysis and

Q&A

What is QSOX1 and what is its primary biochemical function?

QSOX1 (Quiescin Sulfhydryl oxidase 1) is a flavin-linked enzyme that catalyzes the formation of disulfide bonds during protein folding, reducing molecular oxygen to hydrogen peroxide in the process. It plays a crucial role in oxidative protein folding in the endoplasmic reticulum and contributes to the net generation of disulfide bonds . Unlike Protein Disulfide Isomerase (PDI), QSOX1 does not possess disulfide isomerase activity but works cooperatively with PDI to establish proper disulfide linkages in mature proteins . Its enzymatic activity is dependent on conserved CXXC motifs and a non-covalently bound FAD cofactor that is essential for electron transfer during catalysis.

What are the structural characteristics of rat QSOX1?

Rat QSOX1 is a homodimeric protein stabilized by extensive noncovalent interactions and a network of hydrogen bonds. It contains a noncovalently bound FAD in a unique motif that was initially found only in the related protein ERV2p . The crystal structure at 1.8 Å resolution reveals a distinctive spatial orientation of the FAD and a series of stacked aromatic ring side chains that contribute to its stability and function . QSOX1 contains conserved CXXC motifs, which are distinct from those found in thioredoxin and glutaredoxin reductases. The protein exists in two major isoforms: the long form (QSOX1-L) and the short form (QSOX1-S), which differ in their C-terminal regions.

How is the enzymatic activity of recombinant rat QSOX1 measured in experimental settings?

The enzymatic activity of QSOX1 can be measured through several complementary approaches:

  • Thiol oxidation assays: Monitoring the oxidation of reduced thiols (such as DTT or glutathione) spectrophotometrically at 340nm by tracking the disappearance of free thiols over time.

  • Hydrogen peroxide detection: Using coupled enzyme assays where H₂O₂ production is linked to peroxidase-mediated oxidation of a chromogenic or fluorogenic substrate.

  • FAD redox state monitoring: Following changes in the FAD absorption spectrum during catalysis, particularly the formation of a semiquinone intermediate which has a characteristic spectrum .

  • Protein substrate assays: Tracking the formation of disulfide bonds in reduced protein substrates through changes in electrophoretic mobility, fluorescence properties, or enzymatic activity restoration.

Notable experimental findings indicate that mutation of specific cysteine residues (C62 and C65) results in loss of enzymatic activity, demonstrating their critical role in the catalytic mechanism . Additionally, under anaerobic conditions with DTT as a reducing agent, QSOX1 typically forms a stable semiquinone rather than becoming fully reduced, distinguishing it from related enzymes like ERV2p .

How does QSOX1 contribute to cancer progression and what explains contradictory findings?

QSOX1 exhibits context-dependent roles in cancer, which explains the seemingly contradictory findings in the literature. Several mechanisms have been identified:

Role in CancerUnderlying MechanismSupporting EvidenceReference
Tumor promotionFacilitates dormant cancer stem cell immune evasionIncreases PD-L1 expression and promotes T-cell exclusion
Tumor suppressionReduces proliferation and invasionDecreases matrix metalloproteinase activity and promotes adhesion to ECM
Protection against oxidative stressReduces ROS levelsProtects against oxidative stress-induced apoptosis
Autophagy inhibitionInhibits autophagosome/lysosome fusionQSOX1 null tumors show lower p62 protein levels

The contradictions likely stem from:

  • Different cellular contexts and cancer types (breast vs. pancreatic vs. prostate)

  • Variation in experimental models and methodologies

  • Differential effects on primary tumors versus dormant or metastatic disease

  • Isoform-specific functions (QSOX1-L vs. QSOX1-S)

For instance, Morel et al. reported that QSOX1 protects MCF-7 cells against oxidative stress-induced apoptosis , while Katchman et al. demonstrated that QSOX1 enhances invasion in pancreatic cancer . These seemingly contradictory findings highlight the complexity of QSOX1's role in cancer biology and the need for careful experimental design considering cancer subtype, stage, and microenvironmental factors.

What mechanisms explain QSOX1's role in immune modulation and tumor dormancy?

Recent research has revealed that QSOX1 plays crucial roles in modulating anti-tumor immunity and promoting tumor dormancy through several mechanisms:

  • Creation of an oxidative niche: Quiescent fibroblast-derived QSOX1 shapes an oxidative microenvironment that facilitates dormant cancer stem cells (DCSCs) to evade immune elimination .

  • Upregulation of immune checkpoint signaling: QSOX1 promotes the expression of PD-L1 in cancer cells by elevating reactive oxygen species levels, thereby suppressing T cell-mediated anti-tumor immunity .

  • T cell exclusion: High QSOX1 expression in the tumor microenvironment contributes to the exclusion of CD8+ T cells, further enhancing immune evasion .

  • Therapeutic implications: Blocking QSOX1 with inhibitors such as Ebselen, combined with anti-PD-1 immunotherapy and chemotherapy, effectively eradicates residual DCSCs by reducing PD-L1 expression and promoting CD8+ T cell infiltration in experimental models .

  • Clinical relevance: High expression of QSOX1 correlates with poor response to anti-PD-1 treatment in patients with esophageal cancer, suggesting its potential value as a predictive biomarker for immunotherapy efficacy .

These findings connect QSOX1's enzymatic function to broader immunomodulatory effects, demonstrating how a single protein can influence complex intercellular interactions within the tumor microenvironment.

How is QSOX1 involved in cardiovascular disease pathophysiology?

QSOX1 has emerged as a significant player in cardiovascular pathophysiology, particularly in the context of myocardial infarction (MI) and subsequent left ventricular dysfunction:

  • Expression in cardiovascular disease: QSOX1 RNA levels are significantly elevated in peripheral blood of patients who develop left ventricular dysfunction following acute myocardial infarction .

  • Prognostic biomarker: In an external validation cohort, QSOX1 and PLBD1 (Phospholipase B Domain Containing 1) were confirmed to be significantly higher expressed in patients who developed LV dysfunction at 4 months post-MI compared to those who maintained normal function (1.31-fold increase, p<0.001) .

  • Independent predictor: Multivariate analysis demonstrated that QSOX1 is an independent predictor of LV dysfunction with an odds ratio of 1.43 (95% CI: 1.08-1.89), even after adjusting for conventional clinical and biochemical variables .

  • Correlation with cardiac markers: QSOX1 shows statistically significant positive correlation with leukocyte and neutrophil count, peak levels of cardiac troponin T (cTnT), and NT-proBNP, and negative correlation with ejection fraction at follow-up .

  • Predictive model improvement: Adding QSOX1 to conventional clinical prediction models improved their predictive value as measured by Akaike information criteria (AIC) .

These findings suggest that QSOX1 may be involved in the pathophysiological processes that lead to adverse cardiac remodeling following MI, though the precise molecular mechanisms remain to be fully elucidated.

What is the emerging role of QSOX1 as a biomarker for non-alcoholic fatty liver disease (NAFLD)?

Recent research has identified QSOX1 as a promising biomarker for NAFLD diagnosis and severity assessment:

  • Expression correlation with NAFLD progression: RNA-seq and proteomics data analysis revealed that QSOX1 expression increases progressively with NAFLD severity, from simple steatosis to inflammation, fibrosis, and cirrhosis .

  • QSOX1/IL1RAP ratio as a diagnostic biomarker: The ratio of QSOX1 to IL1RAP (Interleukin-1 receptor accessory protein) in plasma demonstrated remarkable effectiveness in diagnosing NAFLD:

    • Proteomics analysis: AUROC of 0.95, sensitivity 90%, specificity 100%, cutoff value 1.12

    • ELISA validation: AUROC of 0.82

  • Cirrhosis detection: For differentiating cirrhosis patients from healthy controls, the QSOX1/IL1RAP ratio achieved an AUROC of 0.96 with 90% sensitivity and 100% specificity .

  • Comparative performance: The QSOX1/IL1RAP ratio outperformed either QSOX1 or IL1RAP alone as diagnostic markers .

  • Database development: Researchers have generated a publicly accessible database (https://dreamapp.biomed.au.dk/NAFLD/) that allows exploration of gene expression changes along NAFLD progression, facilitating further research on QSOX1 and other potential biomarkers .

This emerging application provides a promising non-invasive alternative to liver biopsy for NAFLD diagnosis and staging, though larger validation studies are needed before clinical implementation.

What are optimal expression and purification strategies for recombinant rat QSOX1?

Successful production of active recombinant rat QSOX1 requires careful consideration of expression systems and purification strategies:

Expression SystemAdvantagesDisadvantagesConsiderations
E. coliHigh yield, cost-effective, rapid expressionLimited post-translational modificationsEnsure proper FAD incorporation
YeastBetter protein folding, some post-translational modificationsModerate yield, longer production timeSuitable for functional studies
BaculovirusMammalian-like post-translational modificationsComplex setup, higher costGood for structural studies
Mammalian cellsNative-like modifications, proper foldingLower yield, highest costBest for studies requiring authentic protein

Purification strategy:

  • Expression with an affinity tag (His-tag is commonly used)

  • Initial capture with immobilized metal affinity chromatography

  • Secondary purification with size exclusion chromatography or ion exchange chromatography

  • Quality control to verify:

    • Purity (>90% by SDS-PAGE)

    • FAD incorporation (yellow color, characteristic absorbance spectrum)

    • Enzymatic activity using thiol oxidation assays

Critical parameters:

  • Include glycerol in storage buffers to maintain stability

  • Avoid repeated freeze-thaw cycles

  • Monitor FAD incorporation spectroscopically

  • For long-term storage, maintain at -20°C or -80°C

How can researchers overcome challenges in studying QSOX1-protein interactions?

Investigating QSOX1-protein interactions presents unique challenges due to the transient nature of enzyme-substrate interactions and the redox-sensitive properties of these interactions. Several methodological approaches can help overcome these challenges:

  • Trapping transient enzyme-substrate complexes:

    • Use substrate-trapping mutants (e.g., CXXC to CXXA mutations) that form stable mixed disulfides with substrates

    • Apply rapid kinetic methods like stopped-flow spectroscopy to capture short-lived intermediates

    • Employ chemical crosslinking with variable-length crosslinkers to stabilize interactions

  • Maintaining appropriate redox conditions:

    • Control oxygen levels to prevent non-specific oxidation

    • Include appropriate redox buffers to maintain physiological thiol/disulfide ratios

    • Consider compartment-specific redox potentials when designing experiments (ER is more oxidizing than cytosol)

  • Proximity-based approaches for in vivo interactions:

    • Implement BioID or APEX2 proximity labeling to identify proteins near QSOX1 in living cells

    • Use split-protein complementation assays that reconstitute a reporter protein upon QSOX1-substrate interaction

    • Apply FRET-based sensors to detect conformational changes during substrate binding

  • Mass spectrometry strategies:

    • Utilize differential cysteine alkylation to track changes in thiol oxidation state

    • Implement quantitative proteomics (SILAC, TMT) to compare proteomes with and without QSOX1 activity

    • Apply redox proteomics approaches to identify proteins whose disulfide status changes in response to QSOX1

  • Computational predictions to narrow candidate interactors:

    • Filter for secretory pathway proteins containing multiple cysteines

    • Apply structural modeling to predict potential disulfide-bonded substrates

    • Use machine learning approaches trained on known substrates to predict new interactions

These approaches should be applied in combination to build a comprehensive understanding of QSOX1's interactome and substrate specificity.

What experimental designs are most appropriate for resolving contradictory findings about QSOX1 in cancer?

To address the contradictory findings regarding QSOX1's role in cancer, researchers should implement rigorous experimental designs that account for context-specific effects:

  • Standardized cellular models:

    • Use authenticated cell lines with documented QSOX1 expression levels

    • Implement both gain-of-function (overexpression) and loss-of-function (knockdown/knockout) approaches in the same cellular backgrounds

    • Include multiple cell lines representing different molecular subtypes of the same cancer to identify context-dependent effects

  • Isoform-specific analysis:

    • Specifically target QSOX1-L or QSOX1-S to distinguish isoform-specific functions

    • Use isoform-specific antibodies for detection in patient samples

    • Perform rescue experiments with individual isoforms to identify which can restore particular phenotypes

  • Consistent functional assays:

    • Apply standardized assays for proliferation, invasion, and migration

    • Measure both short-term and long-term effects on cell behavior

    • Include relevant microenvironmental factors (ECM components, co-culture with stromal cells)

  • Mechanistic investigations:

    • Distinguish enzyme-dependent from enzyme-independent functions using catalytically inactive mutants

    • Examine effects on specific molecular pathways (e.g., autophagy, ROS signaling, ECM organization)

    • Investigate both cell-autonomous effects and effects on the tumor microenvironment

  • Translational relevance:

    • Correlate experimental findings with patient data stratified by cancer subtype and stage

    • Use patient-derived xenografts or organoids to validate findings in more clinically relevant models

    • Integrate multi-omics approaches to capture the complexity of QSOX1's effects

These approaches will help resolve contradictions by defining the specific contexts in which QSOX1 promotes or inhibits cancer progression, leading to more nuanced understanding of its role in carcinogenesis.

What are the most promising therapeutic strategies targeting QSOX1?

Based on current understanding of QSOX1 biology, several therapeutic strategies show promise for various disease contexts:

  • Inhibition strategies for cancer therapy:

    • Small molecule inhibitors: Ebselen has shown efficacy in combination with immunotherapy and chemotherapy for eliminating dormant cancer stem cells

    • Monoclonal antibodies targeting extracellular QSOX1 could disrupt tumor-stroma interactions

    • Genetic suppression via siRNA or antisense oligonucleotides for targeted delivery to tumor cells

  • Therapeutic combinations with highest potential:

    • QSOX1 inhibition + immune checkpoint blockade: Targeting both QSOX1 and PD-1/PD-L1 could overcome resistance to immunotherapy

    • QSOX1 inhibition + autophagy modulators: Since QSOX1 inhibits autophagy, this combination could enhance therapeutic efficacy in certain cancers

    • QSOX1 inhibition + chemotherapy: May prevent development of dormant cancer cell populations resistant to conventional therapies

  • Patient stratification strategies:

    • High QSOX1 expression predicts poor response to anti-PD-1 treatment in esophageal cancer patients

    • The QSOX1/IL1RAP ratio could identify NAFLD patients who might benefit from early intervention

    • Elevated blood QSOX1 levels could identify MI patients at high risk for developing left ventricular dysfunction who would benefit from more aggressive treatment

  • Biomarker applications:

    • Diagnostic: QSOX1/IL1RAP ratio for non-invasive NAFLD diagnosis and staging

    • Prognostic: Blood QSOX1 levels for predicting post-MI cardiac remodeling

    • Predictive: Tumor QSOX1 expression for immunotherapy response prediction

  • Potential limitations to address:

    • Tissue and context specificity of QSOX1 function requires careful targeting

    • Potential compensatory mechanisms through related sulfhydryl oxidases

    • Need to distinguish between acute and chronic inhibition effects

These therapeutic strategies are currently in preclinical development, with translation to clinical applications requiring further validation and optimization.

What key questions remain unanswered about QSOX1 biology?

Despite significant advances in understanding QSOX1, several critical questions remain unresolved that warrant further investigation:

  • Substrate specificity determinants:

    • What structural features determine which proteins are preferentially oxidized by QSOX1?

    • How does QSOX1 distinguish between different cysteine pairs within complex proteins?

    • Why is PDI not a substrate for QSOX1 despite containing multiple CXXC motifs?

  • Physiological regulation:

    • What are the precise mechanisms regulating QSOX1 expression in different tissues and disease states?

    • How is QSOX1's enzymatic activity modulated post-translationally?

    • What determines the balance between intracellular retention and secretion of QSOX1?

  • Evolutionary biology:

    • Why have multiple sulfhydryl oxidase families evolved (QSOX, ERV/ALR)?

    • What are the functional advantages of combining thioredoxin-like and ERV domains in QSOX enzymes?

    • How are QSOX functions distributed across isoforms and related enzymes in different species?

  • Disease mechanisms:

    • How does QSOX1 promote PD-L1 expression and T cell exclusion at the molecular level?

    • What explains QSOX1's apparently contradictory roles in different cancer types?

    • How does QSOX1 contribute to cardiovascular pathology after myocardial infarction?

    • What is the functional significance of QSOX1 upregulation in NAFLD progression?

  • Therapeutic potential:

    • Can QSOX1 inhibition effectively overcome immunotherapy resistance in clinical settings?

    • What are the long-term consequences of QSOX1 inhibition on normal physiology?

    • How can delivery of QSOX1-targeting therapeutics be optimized for specific disease contexts?

Addressing these questions will require integrated approaches combining structural biology, systems biology, and translational research to fully elucidate QSOX1's complex biology and therapeutic potential.

How might new technologies advance QSOX1 research in the coming years?

Emerging technologies are poised to transform our understanding of QSOX1 biology and accelerate its translational applications:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy to visualize QSOX1 interacting with substrates at near-atomic resolution

    • Hydrogen-deuterium exchange mass spectrometry to map conformational changes during catalysis

    • AlphaFold2 and related AI platforms to predict QSOX1 interactions with unprecedented accuracy

    • Time-resolved X-ray crystallography to capture intermediate states in the catalytic cycle

  • Single-cell technologies:

    • Single-cell transcriptomics to define cell type-specific expression patterns of QSOX1 in complex tissues

    • Single-cell proteomics to measure QSOX1 protein levels and post-translational modifications

    • Spatial transcriptomics to map QSOX1 expression within tissue architecture

    • Cell-specific in vivo CRISPR-Cas9 editing to dissect tissue-specific functions

  • Novel disease models:

    • Organoids and microphysiological systems ("organs-on-chips") to study QSOX1 in physiologically relevant contexts

    • Patient-derived xenografts to evaluate QSOX1-targeting therapies in personalized models

    • CRISPR-engineered animals with conditional or inducible QSOX1 modifications

    • Humanized mouse models to study QSOX1's immunomodulatory functions

  • Advanced imaging:

    • Super-resolution microscopy to visualize QSOX1 trafficking at nanoscale resolution

    • Intravital microscopy with reporters to track QSOX1 activity in living organisms

    • Redox-sensitive fluorescent probes to monitor QSOX1 activity in real-time

    • Correlative light and electron microscopy to link QSOX1 function to ultrastructural features

  • Therapeutic development platforms:

    • High-throughput screens for QSOX1 inhibitors with improved specificity and pharmacokinetics

    • Antibody engineering technologies to develop QSOX1-targeting biologics

    • mRNA and lipid nanoparticle delivery systems for QSOX1-modulating therapeutics

    • PROTAC (Proteolysis Targeting Chimera) technology to achieve selective QSOX1 degradation

These technological advances, individually and in combination, will facilitate a deeper understanding of QSOX1 biology and accelerate the development of QSOX1-based diagnostics and therapeutics for multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.