Recombinant Rat Suppressor of tumorigenicity 7 protein (St7)

Shipped with Ice Packs
In Stock

Description

Role in Cancer and Tumorigenesis

ST7 was initially proposed as a tumor suppressor, but its expression in cancers is inconsistent:

  • Downregulation: Observed in some carcinomas, potentially linked to reduced extracellular matrix remodeling (e.g., SPARC, IGFBP5) .

  • Upregulation: Detected in other cancers, suggesting context-dependent roles .

  • Mechanistic Insights: ST7 may modulate matrix metalloproteinases (MMPs) and influence cell adhesion .

Gene-Chemical Interactions

ST7 expression is influenced by environmental and therapeutic agents, as evidenced by studies in rodent models:

ChemicalEffect on ST7 ExpressionMechanism
Bisphenol AIncreased methylation and mRNA expression Epigenetic regulation
Cadmium ChlorideUpregulated mRNA levels Heavy metal exposure response
TestosteroneDecreased mRNA expression Hormonal regulation
CisplatinReduced mRNA expression Chemotherapy response
TetrachlorodibenzodioxinDownregulated mRNA Xenobiotic metabolism

These interactions highlight ST7's potential as a biomarker for toxicological and pharmacological studies .

Comparative Analysis with Other Species

Recombinant Rat St7 shares high homology with human and mouse orthologs, enabling cross-species functional studies:

SpeciesAmino Acid Identity (ECD)Key Applications
Human95%Cancer research, ELISA standards
Mouse97%Knockout models, signaling pathway studies
RatN/AToxicology, drug response profiling

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
St7; Suppressor of tumorigenicity 7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-577
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
St7
Target Protein Sequence
MAEAGSGFLEQLKSCIVWSWTYLWTVWFFLVLFLVYILRVPLRINDNLSTVSMFLNTLTP KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM GVFAKAFLSTLFAPLNFVMEKVESILPSSLWHQLTRI
Uniprot No.

Target Background

Database Links

UniGene: Rn.24435

Protein Families
ST7 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of rat Suppressor of Tumorigenicity 7 (St7) protein?

Rat Suppressor of Tumorigenicity 7 (St7), also known as LRP12 (Low-density Lipoprotein Receptor-related Protein 12), is a type I transmembrane protein belonging to the LDLR superfamily. Based on high homology with mouse ST7 (97% amino acid sequence identity), rat ST7 likely consists of approximately 858 amino acids with a similar domain structure . The protein contains a signal sequence, an extracellular domain featuring CUB domains and LDLR class A domains, a transmembrane domain, and a cytoplasmic domain with motifs involved in endocytosis and signal transduction . The extracellular domain is particularly important for interaction with potential ligands, while the cytoplasmic domain mediates downstream signaling activities. This structural arrangement places St7 in a position to potentially influence both extracellular matrix interactions and intracellular signaling cascades, which may contribute to its reported tumor suppressor functions.

How does rat St7 expression vary across different tissue types?

Based on comparative studies with mouse ST7, rat St7 is likely widely expressed across normal tissues with particularly high expression in cardiac and skeletal muscle tissues . Expression analysis methods such as RT-qPCR and Western blotting typically reveal substantial St7 mRNA and protein levels in fibroblasts, suggesting an important role in connective tissue biology . When investigating tissue-specific expression patterns, researchers should consider using a panel of rat tissues including heart, skeletal muscle, liver, kidney, and brain to establish a comprehensive expression profile. Expression levels may vary significantly during development and in response to pathological conditions, particularly in cancer models where St7 was originally identified as a putative tumor suppressor. Researchers should employ both transcript and protein-level detection methods to account for potential post-transcriptional regulation mechanisms that might influence St7 protein abundance independently of mRNA levels.

What are the established functions of St7 in normal cellular physiology?

While initially characterized primarily for its potential tumor suppressor activity, St7 likely plays fundamental roles in normal cellular processes that extend beyond cancer biology. Based on its structural features and expression pattern, St7 appears to participate in the regulation of extracellular matrix remodeling through its influence on molecules such as SPARC, IGFBP5, and matrix metalloproteinases . The protein's transmembrane configuration suggests it may serve as a receptor or co-receptor involved in signal transduction. The presence of endocytosis motifs in its cytoplasmic domain indicates potential involvement in membrane trafficking and receptor internalization processes. Researchers examining St7's physiological functions should consider experimental approaches that investigate both its extracellular interactions and its effects on intracellular signaling cascades. Techniques such as co-immunoprecipitation, proximity ligation assays, and phosphoproteomic analysis may help elucidate St7's functional protein interaction network in normal rat cells.

What expression systems are optimal for producing functional recombinant rat St7 protein?

For researchers seeking to produce recombinant rat St7 protein, several expression systems offer distinct advantages depending on your experimental requirements. Bacterial expression systems (E. coli) provide high yield but typically struggle with proper folding of complex mammalian proteins like St7 that contain multiple domains and disulfide bonds. For higher fidelity expression, insect cell expression systems using baculovirus vectors represent an excellent compromise between yield and proper post-translational modifications . This approach has been successfully used for related proteins and offers scalability for larger preparations. Mammalian expression systems (CHO or HEK293 cells) provide the most physiologically relevant post-translational modifications and are recommended when studying interaction properties or functional assays . When expressing full-length transmembrane St7, consider using a C-terminal affinity tag to avoid interfering with the signal peptide processing. For studies requiring only the extracellular domain, designing a construct encoding just this region (similar to the approach used with MERS-CoV S protein) can improve solubility and yield .

What purification strategies yield highest purity recombinant rat St7 protein?

Purification of recombinant rat St7 protein typically requires a multi-step approach to achieve research-grade purity (≥95% as assessed by SDS-PAGE) . For His-tagged constructs, immobilized metal affinity chromatography (IMAC) using Ni-NTA resin provides an effective initial capture step, similar to methods used for other recombinant proteins . Following IMAC, size exclusion chromatography (SEC) helps remove aggregates and proteolytic fragments while transferring the protein into a physiologically relevant buffer. For applications requiring exceptional purity, consider incorporating an ion exchange chromatography step between IMAC and SEC. When purifying membrane-associated full-length St7, detergent selection becomes critical—mild non-ionic detergents like DDM or LMNG generally preserve structural integrity. For the extracellular domain alone, standard aqueous buffers are usually sufficient. Throughout purification, monitor protein quality using both SDS-PAGE and functional assays such as binding to known interaction partners. Final preparations should undergo endotoxin testing, particularly if the protein will be used in cell-based assays, with acceptable levels typically below 1 EU/mg protein .

How can researchers verify the structural integrity of purified recombinant rat St7?

Verifying the structural integrity of purified recombinant rat St7 requires multiple complementary approaches. Circular dichroism (CD) spectroscopy provides valuable information about secondary structure content and can confirm proper folding by comparing spectra to those of well-characterized LDL receptor family members. Thermal shift assays offer insights into protein stability and can identify buffer conditions that maximize shelf-life. For more detailed structural analysis, limited proteolysis combined with mass spectrometry can map accessible regions and confirm domain organization. Functional verification through binding assays with known interaction partners provides perhaps the most relevant quality control metric. For transmembrane constructs, reconstitution into nanodiscs or liposomes followed by negative-stain electron microscopy can confirm proper incorporation and orientation. When preparing antibodies against rat St7, epitope mapping using truncation constructs helps ensure recognition of structurally relevant regions. Researchers should establish robust quality control workflows that incorporate multiple methods to ensure batch-to-batch consistency, particularly important when comparing results across different experimental series or when publishing findings that depend on protein function rather than just presence.

What methods are most effective for studying rat St7's potential tumor suppressor activity?

Investigating rat St7's tumor suppressor activity requires multi-faceted approaches spanning molecular, cellular, and in vivo systems. Colony formation assays represent a foundational method—transfect rat cancer cell lines with St7 expression constructs and quantify changes in colony-forming ability compared to controls. Cell proliferation assays using methods such as MTT or BrdU incorporation provide complementary data on growth-inhibitory effects. For mechanistic insights, analyze changes in expression of extracellular matrix molecules known to be modulated by St7, including SPARC, IGFBP5, and matrix metalloproteinases, using RT-qPCR and Western blotting . Cell migration and invasion assays using Boyden chambers can reveal St7's impact on metastatic potential. For in vivo validation, consider xenograft studies in immunodeficient rat models such as the Sprague-Dawley Rag2-null rat, which permits growth of human cancer cell lines manipulated to express various levels of St7 . CRISPR-Cas9 knockout/knockdown approaches in rat cancer cell lines provide valuable loss-of-function data to complement overexpression studies. When designing these experiments, include appropriate controls and validate St7 expression/knockout efficiency through multiple methods to ensure interpretable results.

How can researchers effectively study St7 interactions with the extracellular matrix?

Studying St7 interactions with extracellular matrix (ECM) components requires techniques that can capture both direct binding and functional consequences. Co-immunoprecipitation assays using either tagged recombinant St7 or antibodies against endogenous St7 can identify direct protein-protein interactions with ECM components. Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) provides quantitative binding kinetics data for purified St7 interacting with specific ECM molecules. To study functional effects, matrix degradation assays using fluorescently labeled ECM components can reveal how St7 modulates matrix remodeling activities. Gene expression profiling through RNA-Seq following St7 overexpression or knockdown helps identify ECM-related genes under St7 regulation. For spatial organization, immunofluorescence microscopy with co-localization analysis between St7 and ECM proteins provides valuable insights. In 3D culture systems, such as rat fibroblast-derived matrices or Matrigel cultures, researchers can observe more physiologically relevant St7-ECM interactions. When analyzing results, consider that St7's effects on ECM may be both direct (through its extracellular domain) and indirect (through signaling that alters expression of matrix-modifying enzymes), necessitating careful experimental design to distinguish these mechanisms .

What cell-based assays are recommended for examining St7's effects on signaling pathways?

Investigating St7's effects on cell signaling requires assays that can detect changes in pathway activation across multiple signaling cascades. Phospho-specific Western blotting represents a fundamental approach for monitoring activation of key signaling nodes in pathways potentially affected by St7, including MAPK, PI3K/AKT, and Wnt signaling components. Reporter gene assays using pathway-responsive elements (e.g., TCF/LEF for Wnt, SRE for MAPK) provide functional readouts of pathway activity in response to St7 manipulation. For broader pathway analysis, phospho-protein arrays or mass spectrometry-based phosphoproteomics can identify signaling changes without prior hypotheses about affected pathways. Real-time monitoring of signaling using FRET-based sensors or calcium imaging provides temporal information about St7's immediate effects on signal transduction. When studying St7 in the context of receptor function, ligand binding assays and receptor internalization studies using fluorescently labeled ligands help characterize its potential role in endocytosis. For pathway visualization, immunofluorescence microscopy tracking nuclear translocation of transcription factors (e.g., β-catenin, SMAD proteins) downstream of various signaling cascades can provide spatial information about St7's effects. When designing these experiments, include appropriate positive controls (pathway activators and inhibitors) and time course analyses to capture both rapid and delayed signaling events.

How does rat St7 compare functionally with human St7 in experimental systems?

Comparative functional analysis between rat and human St7 provides crucial insights for translational research relevance. Despite high sequence homology (approximately 95% within the extracellular domain), species-specific functional differences may exist . To systematically compare these orthologs, researchers should develop parallel expression constructs for rat and human St7 with identical tags and regulatory elements to ensure comparable expression levels. Functional rescue experiments in St7-knockout cell lines from both species offer a rigorous approach—transfect human St7 into rat St7-knockout cells and vice versa, then assess complementation of phenotypes. Binding affinity comparisons using purified extracellular domains from both species against potential ligands can reveal species-specific interaction differences. Differential gene expression analysis following overexpression of either rat or human St7 in the same cellular background may highlight species-specific transcriptional effects. For in vivo comparison, consider xenograft studies using immunodeficient rat models such as the Sprague-Dawley Rag2-null rat , comparing growth of cancer cells expressing either rat or human St7. When interpreting results, account for potential confounding factors like different expression levels or cellular context that might influence apparent functional differences between the orthologs.

What are the current contradictions in understanding St7's role in cancer biology?

The scientific literature reveals several contradictions regarding St7's role in cancer biology that warrant careful investigation. While initially characterized as a tumor suppressor, ST7 expression patterns across cancer types show inconsistent downregulation, with some cancers even showing upregulation . This paradox suggests context-dependent functions that may vary by tissue type, cancer stage, or molecular subtype. Another contradiction concerns the mechanistic basis of St7's tumor suppressor activity—whether it acts primarily through modulating the extracellular environment, through direct signaling effects, or both remains unresolved. Researchers investigating these contradictions should design experiments that examine St7's effects across multiple cancer types and stages using consistent methodologies. Patient-derived xenograft models in immunodeficient rats like the Sprague-Dawley Rag2-null strain could provide systems for studying these context-dependent effects. Analysis of large-scale cancer genomics databases (TCGA, ICGC) stratified by molecular subtypes may reveal patterns explaining the variable expression. Functional genomics approaches using CRISPR screens in different cellular contexts could identify synthetic lethal interactions that explain tissue-specific effects. When designing studies addressing these contradictions, consider that St7 may function in a complex network where its effects depend on the presence of specific interaction partners or signaling contexts.

What methodological approaches can overcome challenges in studying transmembrane proteins like St7?

Studying transmembrane proteins like St7 presents unique challenges that require specialized methodological approaches. For structural studies, consider cryo-electron microscopy of St7 reconstituted into nanodiscs or amphipols, which preserve the native membrane environment better than detergent solubilization. Alternatively, focus on expressing and characterizing individual domains—the extracellular domain can be expressed as a secreted construct similar to approaches used for MERS-CoV S protein , while the cytoplasmic domain can be produced with fusion partners to enhance solubility. For functional studies in cells, split-reporter systems like bimolecular fluorescence complementation (BiFC) can localize St7 interactions with potential partners within cellular compartments. Single-molecule tracking using techniques like PALM or STORM provides insights into St7's membrane dynamics and clustering behavior. To study topology and membrane insertion, accessibility assays using membrane-impermeable labeling reagents or protease protection assays can map exposed regions. When manipulating St7 expression in cell lines, inducible expression systems help mitigate selection pressures that might arise from constitutive expression of a potential tumor suppressor. For animal models, tissue-specific conditional knockout approaches using Cre-loxP systems avoid developmental effects that might complicate phenotypic analysis. When publishing methods papers on St7, provide detailed protocols addressing these specific challenges to advance the field more rapidly.

How can rat models be engineered to investigate St7's role in cancer progression?

Engineering rat models to study St7's role in cancer requires strategic approaches spanning from cell lines to whole animals. For in vitro models, CRISPR-Cas9 technology enables precise manipulation of the endogenous St7 gene in rat cell lines—both knockout for loss-of-function studies and knock-in for introducing specific mutations or tags. When designing CRISPR strategies, target multiple functional domains to compare domain-specific effects, and always sequence-verify edited clones to confirm intended modifications. For in vivo models, consider the Sprague-Dawley Rag2-null rat as a platform for xenograft studies, as it permits growth of both cell lines and patient-derived samples . More sophisticated models can be created using CRISPR-mediated somatic genome editing by delivering Cas9 and St7-targeting guide RNAs to specific tissues via viral vectors or electroporation. Conditional knockout models using tissue-specific Cre drivers allow examination of St7 function in specific cell types relevant to cancer initiation and progression. To study St7 in the context of specific oncogenic drivers, develop models combining St7 manipulation with common oncogene expression or tumor suppressor deletion. When designing these models, incorporate reporter systems (fluorescent or luminescent) to facilitate real-time monitoring of tumor growth and metastasis. The interpretability of results from these models depends critically on thorough validation of St7 expression/deletion at both mRNA and protein levels in the relevant tissues.

How can St7 research in rat models inform potential therapeutic applications?

Translating St7 research from rat models to therapeutic applications requires systematic approaches connecting basic mechanisms to clinical relevance. Drug screening platforms using rat cell lines with modified St7 expression can identify compounds that modulate St7-dependent phenotypes. High-throughput screens should include assays measuring proliferation, migration, and ECM remodeling to capture the multifaceted activities of St7. Validated hits can progress to testing in Sprague-Dawley Rag2-null rat xenograft models to assess efficacy against human cancer cells in vivo . For developing St7-targeting biologics, the high homology between rat and human St7 (95% in the extracellular domain) suggests that antibodies developed against rat St7 may cross-react with human St7, accelerating translation. Biomarker discovery studies correlating St7 expression or activity with treatment response in rat models may identify patient stratification strategies for clinical trials. Gene therapy approaches developed in rat models, particularly those using adeno-associated virus (AAV) vectors to restore St7 expression, could inform similar human applications. When evaluating results in rat models, consider pharmacokinetic and pharmacodynamic differences between species that might affect clinical translation. The multi-domain structure of St7 offers opportunities for domain-specific therapeutic approaches—targeting the extracellular domain with antibodies or the cytoplasmic domain with small molecules could provide complementary therapeutic strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.