Recombinant Rat Surfeit locus protein 1 (Surf1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Surf1; Surf-1; Surfeit locus protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Surf1
Target Protein Sequence
MAAVMALTVLRSRITRWPQWACAGPAPFCAVRRSVFGFSVRSGMVCRPHRCCSSTAETAA AKAEDDSFLQWFLLFIPATAFGLGTWQVQRRKWKLKLIAELESRVMAEPIPLPADPMELK NLEYRPVKVRGHFDHSKELYIMPRTMVDPVREARDAGRLSSTESGAYVVTPFHCSDLGVT ILVNRGFVPRKKVNPETRQQGQVLGEVDLVGIVRLTENRKPFVPENNPERSLWYYRDLDA MAKRTGTDPIFIDADFNSTTPGGPIGGQTRVTLRNEHMQYIITWYGLCAATSYLWFRKFV RRTPGV
Uniprot No.

Target Background

Function
A component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex, regulating cytochrome c oxidase assembly.
Database Links
Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Surf1 and what is its primary function?

Surfeit locus protein 1 (Surf1) is a nuclear-encoded small hydrophobic protein that plays a crucial role in mitochondrial function. Its primary function is to aid in the initial assembly of the 13 subunits of cytochrome c oxidase (COX, Complex IV) holoenzyme, which facilitates the final transfer of electrons in the electron transport chain from cytochrome c to molecular oxygen, forming water . This function makes Surf1 an essential component of mitochondrial oxidative phosphorylation. Proper Surf1 function ensures efficient energy production in cells with high metabolic demands, particularly in tissues like heart, skeletal muscle, and brain . The protein's name derives from its location in the "surfeit gene cluster," a group of housekeeping genes with diverse functions.

How does Surf1 deficiency manifest differently across species?

The manifestation of Surf1 deficiency exhibits remarkable species-specific differences:

SpeciesCOX Activity ReductionPhenotypeLifespan Effect
Humans>90%Severe neurological deficits (Leigh syndrome)Reduced lifespan
Mice50-75%Mild mitochondrial dysfunctionEnhanced longevity (~20%)
RatsSimilar to miceMild to moderate effectsSimilar to mice

What disease conditions are associated with Surf1 mutations?

Surf1 mutations are associated with multiple disease conditions, with the most prominent being Leigh syndrome. The complete spectrum includes:

  • Leigh disease/syndrome (most common manifestation)

  • Cerebellar ataxia

  • Charcot-Marie-Tooth disease type 4K

  • Cytochrome-c oxidase deficiency disease

  • Developmental and epileptic encephalopathy 14

  • Ehlers-Danlos syndrome classic type 1

  • Various genetic diseases with mitochondrial dysfunction

  • Kleefstra syndrome 1

These conditions primarily manifest due to energy metabolism disruption in tissues with high energetic demands. The most well-studied is Leigh syndrome, a progressive neurological disorder characterized by psychomotor regression, lactic acidosis, and characteristic lesions in the brain, particularly the basal ganglia and brainstem . The severity of these conditions correlates with the degree of Complex IV activity reduction, explaining why human pathology is typically more severe than phenotypes observed in research models .

What experimental techniques are used to generate Surf1-deficient models?

The most common approach to generating Surf1-deficient models involves targeted gene modification techniques:

TechniqueApplicationAdvantagesLimitations
Gene knockoutComplete deletion of Surf1 geneClear phenotypeMay cause embryonic lethality
Truncated protein expressionExpression of unstable proteinMimics most common human mutationsVariable protein stability
Conditional knockoutTissue-specific Surf1 deletionAllows study of tissue-specific effectsMore complex breeding schemes
CRISPR/Cas9Precise genetic modificationFaster development, higher specificityOff-target effects possible

The most extensively studied Surf1-/- mouse model was engineered to express a truncated and unstable Surf1 protein . This approach successfully reduced Complex IV activity by 50-75% across various tissues while allowing viable offspring for study. When designing research models, it's important to consider the desired degree of Complex IV impairment, as this significantly impacts the resulting phenotype. Complete loss versus partial reduction can produce dramatically different outcomes, as evidenced by the contrast between human pathology and mouse models .

How is mitochondrial function assessed in Surf1-deficient models?

Comprehensive assessment of mitochondrial function in Surf1-deficient models requires multiple complementary approaches:

AssessmentMethodologyParameters MeasuredRelevance to Surf1
Enzymatic activitySpectrophotometric assaysComplex I-IV activityDirectly measures Complex IV reduction
RespirometryOxygen electrode, Seahorse XFState 3/4 respiration, RCRFunctional impact of reduced COX
Membrane potentialFluorescent probes (TMRM, JC-1)ΔψmEnergy coupling efficiency
ATP productionLuciferase assaysATP synthesis rateBioenergetic output
ROS generationFluorescent/luminescent probesSuperoxide, H₂O₂Oxidative stress assessment

In Surf1-/- mice, these techniques have revealed tissue-specific effects on mitochondrial function. Heart mitochondria show a 16% decrease in state 3 respiration and a 19% decrease in membrane potential, while skeletal muscle mitochondria show minimal functional changes despite similar reductions in Complex IV activity . These assessments should be conducted both in isolated mitochondria and in intact tissues to bridge the gap between in vitro and in vivo findings.

How does Surf1 deficiency impact mitochondrial stress response pathways?

Surf1 deficiency initiates a coordinated set of mitochondrial stress responses that may contribute to the paradoxical benefits observed in mouse models:

Stress ResponseMechanismObserved Changes in Surf1-/-Potential Benefit
UPRᵐᵗUpregulation of mitochondrial chaperonesIncreased expression of stress proteinsImproved protein quality control
Mitochondrial biogenesisPGC-1α pathway activationIncreased mitochondrial contentCompensates for reduced Complex IV
Nrf2 activationAntioxidant responseEnhanced antioxidant defenseReduced oxidative damage
Metabolic reprogrammingShift to alternative pathwaysIncreased glycolysis, altered substrate utilizationMetabolic flexibility

Research in Surf1-/- mice has demonstrated that despite substantial reduction in Complex IV activity, these animals activate compensatory mechanisms that not only prevent catastrophic bioenergetic failure but may also contribute to extended lifespan . Investigation of these pathways requires measurements of mitochondrial mass (through citrate synthase activity), mitochondrial DNA copy number (qPCR), and expression of key transcription factors like PGC-1α . The proper methodology includes tissue homogenization followed by subcellular fractionation, with careful normalization to either total protein or tissue weight.

What explains the discrepancy between in vitro and in vivo findings in Surf1-deficient models?

The discrepancy between isolated mitochondria (in vitro) and physiological (in vivo) results represents a key research question in Surf1 studies:

ParameterIn Vitro FindingIn Vivo ObservationPotential Explanation
RespirationMild decrease in state 3 respirationNormal whole-animal respirationCompensatory mechanisms, tissue adaptation
ATP productionNo significant changeSufficient for basal functionMetabolic remodeling, efficiency improvements
Exercise capacityN/ASignificantly reduced enduranceThreshold effect under physiological stress
Blood lactateN/AElevated at rest and post-exerciseShift toward anaerobic metabolism

Research with Surf1-/- mice has revealed that despite only mild alterations in isolated mitochondrial function, these animals demonstrate clear physiological limitations during exercise challenges . They show normal basal activity but significantly decreased endurance capacity associated with elevated blood lactate levels, indicating greater reliance on anaerobic glycolysis . This discrepancy highlights the importance of combining in vitro assessments with physiological testing when studying mitochondrial mutations. Researchers should implement both isolated mitochondria studies and whole-organism phenotyping, including exercise testing, metabolic cage analysis, and tissue-specific functional assessments to comprehensively understand Surf1 deficiency effects.

How do tissue-specific effects of Surf1 deficiency manifest at the molecular level?

Surf1 deficiency produces distinct molecular signatures across different tissues:

TissueCOX Activity ReductionMolecular ChangesFunctional Impact
Heart>70%Decreased state 3 respiration, lower membrane potentialMild cardiac adjustments
Skeletal muscle~50%Minimal changes in isolated mitochondriaReduced grip strength, exercise intolerance
Brain50-70%Increased ROS, elevated glucose metabolismEnhanced memory, increased cerebral blood flow
Adipose tissueVariableInduction of mitochondrial biogenesisReduced adiposity, increased insulin sensitivity

The mechanisms behind these tissue-specific effects remain incompletely understood but may relate to tissue-specific threshold effects . For example, the heart shows greater reduction in Complex IV activity (>70%) compared to skeletal muscle (~50%), potentially explaining the more pronounced changes in cardiac mitochondrial function . Additionally, tissues differ in their capacity to induce compensatory mechanisms. Methodologically, researchers should employ tissue-specific isolation techniques for mitochondria, considering the unique properties of each tissue. Proteomic and transcriptomic analyses can reveal tissue-specific adaptations to Surf1 deficiency, while metabolomic approaches can identify altered metabolic signatures.

What mechanisms could explain the paradoxical longevity in Surf1-deficient mice?

The enhanced longevity in Surf1-/- mice despite reduced Complex IV activity aligns with the mitohormesis hypothesis:

Proposed MechanismEvidence from Surf1-/- MiceResearch Methodology
Hormetic ROS signalingMild increase in ROS productionDCF fluorescence, MitoSOX, protein carbonylation
Metabolic efficiencyMetabolic remodeling observedRespirometry, metabolomics, glucose tolerance
Enhanced stress resistanceActivation of stress response pathwaysWestern blot for stress proteins, gene expression
Improved proteostasisUPRᵐᵗ inductionProtein aggregation assays, proteasome activity
Reduced inflammationNot yet confirmed in Surf1-/-Cytokine profiling, NFκB signaling assessment

How does Surf1 deficiency affect energy metabolism during exercise?

Surf1 deficiency significantly impacts energy metabolism during exercise:

ParameterObservation in Surf1-/-Methodological Approach
Basal activityNo significant changeOpen field activity monitoring
Endurance capacitySignificantly reducedTreadmill running test
Blood lactateElevated at rest (+28%), further increased with exercise (+55-72%)Blood lactate analyzer
Muscle strengthDecreased grip strength (-13%)Grip strength meter
Oxygen consumptionSimilar at rest, limited during intense exerciseMetabolic cage, exercise calorimetry

These findings indicate that Surf1-/- mice maintain normal energy homeostasis at rest but cannot meet increased energetic demands during physical challenges . The elevated blood lactate levels prior to and after exercise suggest a greater reliance on anaerobic glycolysis for ATP production . This metabolic shift represents a compensatory mechanism for the reduced capacity of aerobic metabolism due to Complex IV deficiency. For comprehensive assessment, researchers should combine multiple techniques including treadmill testing with gas exchange measurement, in vivo muscle energetics using ³¹P-MRS, and tissue sampling for metabolite profiling before and after exercise challenges.

What are the optimal techniques for measuring Complex IV activity in Surf1 research?

Accurate measurement of Complex IV activity is central to Surf1 research:

TechniquePrincipleAdvantagesLimitationsApplication in Surf1 Research
Spectrophotometric assayOxidation of reduced cytochrome cStandardized, quantitativeRequires isolated mitochondriaConfirmed 53-71% reduction in Surf1-/- tissues
PolarographyOxygen consumption with specific substratesReal-time measurementTechnical complexityShowed 16% decrease in state 3 respiration
HistochemistryTissue section stainingPreserves tissue architectureSemi-quantitativeNot detailed in provided studies
Blue Native PAGEProtein complex separationPreserves complex integrityLabor intensiveCan assess complex assembly
In-gel activityActivity staining after BN-PAGEDirect visualizationLimited quantificationUseful for assembly intermediates

When measuring Complex IV activity in Surf1-deficient models, researchers should consider several methodological factors. First, proper tissue harvesting and mitochondrial isolation techniques are critical—tissues should be processed rapidly to prevent degradation, and isolation buffers must maintain mitochondrial integrity . Second, normalization approaches significantly impact interpretation—activity can be normalized to total protein, citrate synthase activity (mitochondrial mass marker), or tissue weight. Finally, temperature control is essential as enzymatic activities are highly temperature-dependent. The validated spectrophotometric method shows that Surf1-/- mice exhibit a 71% reduction in heart and 53% reduction in skeletal muscle Complex IV activity compared to wild-type controls .

How should researchers integrate physiological and molecular data in Surf1 studies?

Effective integration of physiological and molecular data requires a multi-level experimental approach:

Data TypeMeasurement TechniquesIntegration Approach
MolecularETC complex activities, protein expression, gene expressionCorrelation analysis with physiological outcomes
CellularIsolated mitochondria function, cellular bioenergeticsBridge between molecular and tissue effects
Tissue-specificTissue respiration, metabolite profilingContextualize molecular findings within tissue function
Whole-organismExercise capacity, metabolic rate, lifespanUltimate physiological relevance of molecular changes
TemporalTime-course studiesDistinguish primary effects from compensatory responses

The discrepancy between in vitro and in vivo findings in Surf1-/- mice highlights the importance of integrated approaches . For example, despite minimal changes in isolated skeletal muscle mitochondrial function, Surf1-/- mice show clear exercise intolerance and elevated blood lactate . To bridge this gap, researchers should implement hierarchical experimental designs that examine the same parameters across multiple levels of biological organization. Statistical approaches like principal component analysis can help identify patterns across diverse datasets, while pathway analysis can reveal functional connections between molecular changes and physiological outcomes.

What considerations are important when designing antibodies for Surf1 research?

Designing effective antibodies for Surf1 research requires careful consideration of several factors:

ConsiderationImportanceRecommendations
Epitope selectionDetermines antibody specificityTarget conserved regions outside transmembrane domains
Species cross-reactivityEnables comparative studiesUse highly conserved epitopes if cross-species reactivity is desired
Truncated protein detectionCritical for knockout validationChoose epitopes present in truncated protein, if applicable
Post-translational modificationsMay affect antibody bindingConsider known modifications in epitope selection
Antibody formatImpacts application suitabilityMonoclonal for specificity, polyclonal for sensitivity
Validation methodsEnsures reliabilityWestern blot with appropriate controls, immunoprecipitation

For recombinant rat Surf1 research, antibodies should ideally recognize both wild-type and potential truncated variants to confirm knockout models . Validation should include positive controls (wild-type tissue), negative controls (confirmed Surf1-/- tissue), and specificity tests using peptide competition. When performing immunological studies of Surf1, researchers should consider its low abundance and membrane localization, which may require optimization of extraction and detection protocols. Additionally, antibodies against other Complex IV assembly factors can provide valuable complementary information about compensatory responses.

What protocols are most effective for assessing mitochondrial stress responses in Surf1-deficient models?

Assessment of mitochondrial stress responses requires multiple complementary approaches:

Stress ResponseAssessment MethodKey MarkersRelevance to Surf1 Deficiency
UPRᵐᵗWestern blot, qRT-PCRHSP60, ClpP, LONP1Activated in response to misfolded proteins
Mitochondrial biogenesisqRT-PCR, mtDNA copy numberPGC-1α, TFAM, NRF1/2Compensatory response to reduced Complex IV
Nrf2 pathwayNuclear translocation, target gene expressionNQO1, GCLC, HO-1Antioxidant response activation
Metabolic adaptationMetabolomics, enzyme activitiesGlycolytic enzymes, TCA cycle intermediatesShift to alternative energy pathways

In Surf1-/- mice, mitochondrial biogenesis has been observed, with significant changes in PGC-1α expression quantified using qRT-PCR . The recommended protocol involves RNA extraction using RNeasy Plus kit, first-strand cDNA synthesis with SuperScript II reverse transcriptase, and quantitative real-time PCR with Power SYBR Green PCR Master Mix using the comparative method (2^-ΔΔCT) . For accurate quantification, appropriate reference genes like gamma-actin should be used for normalization . When assessing these stress responses, tissue-specific effects should be considered, as heart and skeletal muscle may show different patterns of activation in response to Surf1 deficiency.

How can researchers effectively measure physiological impacts of Surf1 deficiency?

Comprehensive physiological assessment of Surf1-deficient models should include:

Physiological ParameterMeasurement TechniqueFindings in Surf1-/- MiceMethodological Considerations
Basal activityOpen-field activity monitoringNo significant difference40-hour monitoring with 16-hour habituation
Exercise enduranceTreadmill running testSignificantly decreasedProgressive protocol with defined endpoints
Anaerobic metabolismBlood lactate measurementElevated at rest and post-exerciseSamples at rest, during, and after exercise
Muscle strengthGrip strength meterDecreased (-13%)Multiple measurements, normalization to body weight
Whole-body metabolismMetabolic chambersSimilar to wild-type at restFood intake, O₂ consumption, CO₂ production

The protocols used in Surf1-/- mouse studies demonstrate effective approaches to physiological assessment . Open-field activity monitoring involved placing mice in a clear cage (16"×9"×5.5") with a grid size (7×15) for 40 hours, with data recorded after a 16-hour habituation period . Exercise capacity was tested using a mouse treadmill with standardized protocols . Blood lactate was measured at rest and following 15 and 35 minutes of moderate exercise . These complementary approaches provide a comprehensive view of how Complex IV deficiency affects physiological function across different activity levels, revealing that while basal function is maintained, performance under physiological stress is compromised.

How might Surf1 research inform potential therapeutic approaches for mitochondrial disorders?

The insights from Surf1 research suggest several therapeutic strategies for mitochondrial disorders:

Therapeutic ApproachRationale from Surf1 ResearchResearch Methodology
Mitochondrial biogenesis inductionObserved as beneficial compensationPGC-1α activators, exercise mimetics
UPRᵐᵗ modulationImproved protein quality controlSmall molecules targeting UPRᵐᵗ pathways
Metabolic reprogrammingSuccessful adaptation in Surf1-/-Substrate availability modification
Hormetic stress inductionMild stress triggers beneficial responsesControlled ROS inducers, caloric restriction
Nrf2 pathway activationEnhanced antioxidant defenseNrf2 activators, antioxidant therapies

The paradoxical finding that Surf1-/- mice exhibit extended lifespan despite COX deficiency provides a unique opportunity to identify beneficial compensatory pathways that could be therapeutically targeted . Future research should focus on determining the minimum level of Complex IV inhibition needed to trigger beneficial responses without causing pathology, identifying tissue-specific responses that could be selectively enhanced, and developing small molecules that can mimic these beneficial adaptations without requiring genetic manipulation. Clinical translation will require careful consideration of timing, as interventions may need to be implemented before disease progression reaches critical thresholds.

What implications does the mitohormesis concept from Surf1 studies have for aging research?

The mitohormesis concept derived from Surf1 studies has significant implications for aging research:

Aspect of AgingRelevance of Surf1 ResearchResearch Opportunities
Lifespan extension20% increase in Surf1-/- miceIdentify translatable mechanisms
Stress resistanceEnhanced in mild mitochondrial dysfunctionTest cross-stressor protection
Metabolic healthImproved in Surf1-/- adipose tissueExplore tissue-specific interventions
Cognitive functionEnhanced memory despite decreased respirationInvestigate neuron-specific adaptations
Exercise physiologyCompromised in Surf1-/- despite longevityDevelop optimal exercise protocols

The finding that Surf1-/- mice live longer despite reduced Complex IV activity aligns with emerging evidence that mild mitochondrial stress can trigger beneficial compensatory responses . This challenges traditional views of mitochondrial function in aging and suggests a more nuanced relationship where the organism's response to mitochondrial stress may be more important than absolute mitochondrial efficiency. Future research should explore how this concept applies across species, whether hormetic effects show tissue specificity, and how aging itself affects the capacity for hormetic responses. Longitudinal studies combining lifespan assessment with periodic molecular and physiological measurements would be particularly valuable.

How might systems biology approaches enhance our understanding of Surf1 function?

Systems biology approaches can provide comprehensive insights into Surf1 function:

Systems ApproachApplication to Surf1 ResearchExpected Insights
Multi-omics integrationCombine transcriptomics, proteomics, metabolomicsNetwork-level adaptations to Surf1 deficiency
Computational modelingSimulate effects of reduced Complex IVPredict metabolic flux changes
Network analysisMap interactions between compensatory pathwaysIdentify key regulatory nodes
Machine learningPattern recognition in complex datasetsNovel biomarkers of beneficial adaptation
Single-cell approachesCell-specific responses to Surf1 deficiencyCellular heterogeneity within tissues

The complexity of responses to Surf1 deficiency—spanning molecular, cellular, and physiological levels—makes this an ideal subject for systems biology investigation . The discrepancy between relatively mild changes in isolated mitochondria and significant physiological effects highlights the need for integrative approaches that can connect these levels of organization . Future research should employ multi-omics approaches to simultaneously assess changes across the transcriptome, proteome, and metabolome in Surf1-deficient models. Network analysis can then identify key regulatory hubs that orchestrate compensatory responses, potentially revealing new therapeutic targets for mitochondrial disorders and age-related conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.