Recombinant Rat Synaptogyrin-2 (Syngr2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Viral Replication

Syngr2 promotes viral replication by facilitating the formation of viral replication factories. Key findings include:

  • SFTSV Interaction: Syngr2 interacts with the nonstructural protein NSs of Severe Fever with Thrombocytopenia Syndrome Virus (SFTSV), enabling reconstruction of lipid droplets into inclusion bodies (IBs) for viral RNA replication. Silencing Syngr2 reduces IB size and viral titers by >50% .

  • PCV2 Replication: In Porcine Circovirus 2 (PCV2), Syngr2 knockdown via CRISPR-Cas9 or siRNA reduces viral replication by 75%–90%, with delayed replication kinetics observed within 24 hours post-infection .

  • Overexpression Impact: Ectopic Syngr2 expression in HeLa cells increases SFTSV titers by 3–5-fold and PCV2 replication efficiency .

Mechanistic Insight: Syngr2’s first intraluminal loop (residues 60–63 in pigs/63–66 in rats) is critical for vesicle membrane integration. The SYNGR2 p.Arg63Cys variant disrupts this domain, reducing PCV2 replication efficiency .

Applications in Research

Recombinant Syngr2 is utilized in:

  • Viral Pathogenesis Studies: Investigating host-pathogen interactions for RNA viruses (e.g., SFTSV) and DNA viruses (e.g., PCV2) .

  • Protein-Protein Interaction Assays: Mapping binding domains using pull-down assays and co-immunoprecipitation .

  • Structural Biology: Analyzing membrane topology via mutagenesis and fluorescence tagging .

Evolutionary and Cross-Species Relevance

Syngr2 is evolutionarily conserved across mammals. The SYNGR2 p.Arg63Cys variant in pigs reduces PCV2 replication, suggesting adaptive host-pathogen dynamics. Structural homology with human SYNGR2 (84% identity) enables translational studies in viral entry mechanisms .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we currently have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
Syngr2; Synaptogyrin-2; Cellugyrin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-224
Protein Length
Full length protein
Species
Rattus norvegicus (Rat)
Target Names
Syngr2
Target Protein Sequence
MESGAYGAANAGGSFDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSSDQLHCV FNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWF VGFCFLTNQWAATKPDDVLVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQN YVDPTPDPTTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY
Uniprot No.

Target Background

Function
Synaptogyrin-2 may play a role in regulated exocytosis. In neuronal cells, it modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore contribute to the formation and/or maturation of these vesicles. It may also play a role in GLUT4 storage and transport to the plasma membrane.
Gene References Into Functions
  1. Small conserved hydrophobic hairpins in the first luminal loop and the carboxyl terminus of cellugyrin were found to be critical for the formation of SLMVs. PMID: 15590695
Database Links
Protein Families
Synaptogyrin family
Subcellular Location
Cytoplasmic vesicle membrane; Multi-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed with lower expression in brain (at protein level).

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.