Recombinant Rat Synaptotagmin-3 (Syt3)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rat Synaptotagmin-3 (Syt3)

Synaptotagmin-3 (Syt3) is a calcium-sensitive integral membrane protein belonging to the synaptotagmin family, which plays critical roles in vesicle trafficking, exocytosis, and synaptic plasticity . Recombinant Syt3 refers to engineered forms of the protein produced in heterologous systems (e.g., bacterial, mammalian, or insect cells) for experimental or therapeutic purposes. These recombinant proteins retain the structural and functional properties of native Syt3, including its transmembrane domain and calcium/phospholipid-binding C2 domains .

Domain Structure

Syt3 consists of:

  1. N-terminal region: Contains a hydrophobic transmembrane domain (~25 amino acids) critical for anchoring to vesicle membranes .

  2. C2 domains: Two internal repeats (C2A and C2B) that bind Ca²⁺ and phospholipids, enabling Syt3 to sense calcium influx and trigger vesicle fusion .

  3. C-terminal tail: Contributes to protein-protein interactions and subcellular localization .

Sequence Homology

Syt3 is evolutionarily conserved but divergent from other synaptotagmins:

IsoformSequence Identity to Syt3Key Homology Region
Rat Syt140.5%C2 domains
Rat Syt238.3%C2 domains
Marine ray p65-C64.0%Full-length
Data compiled from

Tissue-Specific Expression

Syt3 is predominantly expressed in:

  • Brain regions: Hippocampus, cortex, and cerebellum .

  • Neuroendocrine tissues: Adrenal glands and PC12 cells (rat pheochromocytoma cells) .

Expression Systems and Tags

Recombinant Syt3 is produced using:

SourceTagApplications
E. coliHis-tagPurification, biochemical assays
HEK-293 cellsMyc-DYKDDDDKCell culture studies, protein binding assays
Cell-free systems (CFPS)Strep-tagStructural studies, Western blotting

Recombinant Syt3 is used to:

  • Study calcium-dependent vesicle fusion kinetics .

  • Investigate postsynaptic AMPA receptor internalization .

  • Develop therapeutic strategies for neurological disorders .

Role in Synaptic Transmission

  1. Vesicle Resupply: Syt3 accelerates vesicle docking and replenishment during high-frequency neuronal activity, preventing synaptic depression .

    • Knockout mice: Enhanced short-term depression and slowed recovery from depression .

  2. Facilitation and Plasticity: Syt3 enhances short-term synaptic facilitation under low-release probability conditions .

Postsynaptic Functions

Syt3 binds AMPA receptors and adaptor proteins (AP2, BRAG2) to mediate activity-dependent receptor internalization, contributing to long-term depression (LTD) and synaptic memory regulation .

  • Knockout mice: Impaired forgetting in spatial memory tasks (e.g., Barnes maze) .

Disease Relevance

Syt3 mutations are linked to:

  • Epilepsy: Disrupted Ca²⁺ sensing and neurotransmitter release .

  • Autism Spectrum Disorder: Altered synaptic plasticity and social behavior .

Clinical and Therapeutic Implications

Syt3’s role in high-frequency transmission and plasticity positions it as a target for:

  • Gene therapy: Restoring Syt3 function in epilepsy or autism models .

  • Pharmaceuticals: Developing Ca²⁺-sensitive modulators to regulate Syt3 activity .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping is available upon request with an additional charge. Please contact us in advance to arrange this.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Syt3; Synaptotagmin-3; Synaptotagmin III; SytIII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-588
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Syt3
Target Protein Sequence
MSGDYEDDLCRRALILVSDLCARIRDADTNDRCQEFNELRIRGYPRGPDADISVSLLSVIVTFCGIVLLGVSLFVSWKLCWVPWRDKGGSAVGGGPLRKDLAPGVGLAGLVGGGGHHLGASLGGHPLLGGPHHHAHPAHHPPFAELLEPGGLGGSEPPEPSYLDMDSYPEAAVASVVAAGVKPSQTSPELPSEGGTGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTTQADPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRTGGGSGEAGAPCGRISFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPDRKKKFQTKVHRKTLNPIFNETFQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLDNLLELAEQPPDRPLWRDILEGGSEKADLGELNFSLCYLPTAGLLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKKNTLNPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEVIGVCRVGPEAADPHGREHWAEMLANPRKPVEHWHQLVEEKTLSSFTKGGKGLSEKENSE
Uniprot No.

Target Background

Function

Synaptotagmin-3 (Syt3) is a calcium (Ca2+) sensor that plays a critical role in Ca2+-dependent exocytosis of secretory vesicles. This function is mediated through Ca2+ and phospholipid binding to its C2 domain. Ca2+ binding facilitates the interaction of the C2 domains with phospholipid membranes and assembled SNARE complexes, ultimately triggering exocytosis. Syt3 also contributes to melanocyte dendrite formation.

Database Links
Protein Families
Synaptotagmin family
Subcellular Location
Cell membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle membrane; Single-pass membrane protein.
Tissue Specificity
Brain, various endocrine tissues and hormone-secreting clonal cells.

Q&A

What is Synaptotagmin-3 and what are its primary functions in neurons?

Synaptotagmin-3 is an integral membrane protein found in both presynaptic and postsynaptic compartments of neurons. In the postsynaptic region, Syt3 is predominantly localized to endocytic zones where it promotes AMPA receptor internalization . This function is critical for synaptic plasticity mechanisms, particularly long-term depression (LTD). In presynaptic terminals, Syt3 is involved in the fast resupply of synaptic vesicles, which is essential for maintaining reliable synaptic transmission during sustained neuronal activity .

At the molecular level, Syt3 contains C2 domains homologous to the regulatory domain of protein kinase C, which are highly conserved among synaptotagmin isoforms and serve as calcium sensors . These domains enable Syt3 to participate in calcium-dependent membrane trafficking processes crucial for neuronal function.

How does the structure of Synaptotagmin-3 compare to other synaptotagmin isoforms?

Rat Synaptotagmin-3 is a protein consisting of 588 amino acids that shows varying degrees of homology with other synaptotagmin family members . Specifically, it shares:

  • 40.5% amino acid identity with rat Synaptotagmin-1

  • 38.3% identity with rat Synaptotagmin-2

  • 64.0% identity with o-p65-C (a synaptotagmin isoform from marine ray Discopyge ommata)

The most conserved regions across these isoforms are the two internal repeats homologous to the C2 domain (calcium-binding regulatory domain) . These C2 domains are critical for calcium-sensing functionality and proper membrane interactions. The C2B domain specifically plays an important role in the oligomerization of synaptotagmins, a process that can be disrupted experimentally using isolated C2B domains .

What is the expression pattern of Synaptotagmin-3 across different tissues and cell types?

Synaptotagmin-3 exhibits a diverse expression pattern across multiple tissues:

  • In the nervous system: Syt3 mRNA is expressed throughout the developing rat CNS with specific regional distribution patterns .

  • In endocrine tissues: RNA blotting studies have revealed Syt3 expression in various endocrine tissues and hormone-secreting clonal cells .

  • In immune cells: Among synaptotagmins 1-11, Syt3 is the only one expressed in T cells, where it plays a critical role in CXCR4 receptor recycling .

At the subcellular level, Syt3 shows distinct localization patterns depending on cell type:

  • In neurons: Present in both presynaptic and postsynaptic compartments as confirmed by biochemical sub-fractionation of synaptosomes .

  • In mast cells: Over 70% of Syt3 colocalizes with early endosomal markers (EEA1, annexin II, syntaxin 7), while the remaining portion colocalizes with secretory granule markers .

  • In T cells: Primarily localized in multivesicular bodies that also contain CXCR4 receptors .

How does Synaptotagmin-3 contribute to memory formation and forgetting mechanisms?

Synaptotagmin-3 plays a significant role in the molecular mechanisms underlying memory dynamics, particularly in forgetting processes. Studies with Syt3 knockout mice have revealed:

The mechanistic basis for these memory effects involves Syt3's function in AMPA receptor trafficking. During normal synaptic activity, calcium influx through NMDA receptors triggers Syt3-mediated internalization of AMPA receptors, weakening synaptic connections . This process is essential for both synaptic depression and the natural decay of established memories, allowing for adaptive forgetting and relearning. When Syt3 is absent, this receptor internalization is impaired, leading to persistent potentiation and deficits in the ability to update previously learned information.

What role does Synaptotagmin-3 play in endocytic recycling processes?

Synaptotagmin-3 functions as a critical factor in the formation and operation of the endocytic recycling compartment (ERC). Research findings demonstrate:

  • In rat basophilic leukemia cells, >70% of endogenous Syt3 colocalizes with early endosomal markers (EEA1, annexin II, syntaxin 7)

  • Cells with substantially reduced Syt3 levels show:

    • Normal transferrin binding and internalization into early endosomes

    • Disrupted delivery of transferrin to the perinuclear ERC

    • Transferrin remains associated with dispersed peripheral vesicles

    • Rab11 (an ERC marker) remains cytosolic rather than membrane-associated

In T cells, Syt3 plays an essential role in CXCR4 receptor recycling:

  • Syt3 is localized primarily in multivesicular bodies containing CXCR4

  • Impaired Syt3 function blocks CXCR4 recycling, leading to reduced surface levels

  • This reduction in surface CXCR4 inhibits CXCR4-triggered migration

  • Migration can be restored by CXCR4 overexpression, confirming that the defect stems from reduced receptor availability

These findings collectively establish Syt3 as a critical component of cellular recycling machinery across multiple cell types.

What experimental approaches are most effective for studying Synaptotagmin-3 localization in neurons?

Several complementary methodologies have proven effective for investigating Synaptotagmin-3 localization in neuronal tissues:

TechniqueApplicationKey Findings
Immunocytochemistry with isoform-specific antibodiesVisualization of Syt3 distribution relative to other cellular markersRevealed Syt3's presence in postsynaptic endocytic zones and colocalization with endosomal markers
Biochemical sub-fractionationIsolation of synaptosomes with subsequent separation of presynaptic and postsynaptic compartmentsDemonstrated Syt3's presence in both presynaptic and postsynaptic fractions
Synaptosome immunolabelingExamination of isolated synaptosomes for co-localization with specific markersShowed Syt3 in both VGLUT1-positive (presynaptic) and PSD-95-positive (postsynaptic) compartments
Viral expression of tagged Syt3Introduction of fluorescently tagged Syt3 via viral vectorsEnabled visualization in living neurons with confirmation by post-hoc immunohistochemistry
pHluorin-Syt3 experimentsUsing pH-sensitive GFP variants fused to Syt3Allowed monitoring of Syt3 trafficking between compartments with different pH

The combination of these approaches provides researchers with a comprehensive toolkit for examining the dynamic localization and trafficking of Syt3 in neuronal systems.

How does genetic manipulation of Synaptotagmin-3 affect synaptic plasticity mechanisms?

Genetic manipulation of Synaptotagmin-3 produces specific and significant effects on synaptic plasticity mechanisms:

  • Knockout effects:

    • Complete abolishment of long-term depression (LTD)

    • Sustained long-term potentiation (LTP) that fails to decay normally

    • Preserved basic synaptic transmission and short-term plasticity

    • Impaired synaptic vesicle replenishment during high-frequency stimulation

  • Overexpression effects:

    • Basic synaptic transmission and short-term plasticity remain unaltered

    • Enhanced AMPA receptor internalization

  • Domain-specific interventions:

    • Expression of the isolated C2B domain disrupts oligomerization of synaptotagmins

    • C2B domain mutants that bind calcium but don't block oligomerization fail to affect function

These findings indicate that Syt3 plays a specialized role in activity-dependent synaptic modifications rather than in basal synaptic function. The bidirectional effects on LTD (blocked in knockout) and LTP decay (impaired in knockout) suggest that Syt3's primary function involves mechanisms that regulate synaptic strength, particularly through activity-induced AMPA receptor endocytosis.

How do Synaptotagmin-3's functions differ between presynaptic and postsynaptic compartments?

Synaptotagmin-3 serves distinct but complementary functions in presynaptic and postsynaptic compartments:

Presynaptic functions:

  • Facilitates fast resupply of synaptic vesicles during sustained neuronal activity

  • Contributes to maintaining reliable neurotransmission during high-frequency firing

  • Functions independently of calcium channel regulation, as calcium currents remain unaltered in Syt3 knockout calyces

  • Appears to act downstream of calcium influx in the vesicle replenishment process

Postsynaptic functions:

  • Promotes internalization of AMPA receptors from the postsynaptic membrane

  • Mediates activity-dependent weakening of synaptic connections

  • Contributes to long-term depression (LTD) mechanisms

  • Facilitates the normal decay of potentiated synapses over time

  • Plays a role in forgetting processes through receptor internalization

This functional duality allows Syt3 to coordinate both sides of the synapse, potentially contributing to synaptic homeostasis by balancing presynaptic vesicle supply with postsynaptic receptor density.

What are the most effective approaches for generating and validating Synaptotagmin-3 knockout models?

Creating effective Synaptotagmin-3 knockout models requires careful consideration of both genetic strategy and validation methods:

Genetic manipulation strategies:

  • Conventional gene knockout: Global deletion of the Syt3 gene in mice, effective for studying systemic functions

  • Conditional knockout: Using Cre-loxP systems for cell-type-specific or temporally-controlled deletion

  • RNA interference: Stable transfection with Syt3 antisense cDNA (demonstrated to reduce expression by >90%)

  • Dominant-negative approaches: Expression of isolated C2B domain to disrupt function

Validation methods:

  • Molecular confirmation:

    • Western blot analysis of tissue lysates to verify protein absence

    • RT-PCR to confirm reduced mRNA expression

    • Immunohistochemistry to visualize loss of Syt3 in target tissues

  • Functional validation:

    • Electrophysiological assessment of LTD and LTP, which should show characteristic alterations

    • Receptor internalization assays to confirm impaired AMPA receptor endocytosis

    • Behavioral testing focusing on memory flexibility and forgetting processes

  • Rescue experiments:

    • Viral reintroduction of Syt3 in knockout tissues (e.g., AAV vector expressing Syt3 and GFP)

    • Post-hoc immunohistochemistry to confirm successful expression

    • Functional testing to demonstrate phenotype reversal

This comprehensive approach ensures that any observed phenotypes can be confidently attributed to the specific loss of Syt3 function.

What techniques can effectively assess Synaptotagmin-3's interaction with AMPA receptors?

Investigating the interaction between Synaptotagmin-3 and AMPA receptors requires a multi-faceted approach:

  • Receptor internalization assays:

    • Surface biotinylation followed by immunoprecipitation

    • Antibody feeding assays using antibodies against extracellular domains of AMPA receptor subunits

    • Quantification of surface receptor levels before and after stimulation protocols

  • Imaging approaches:

    • Co-localization studies using confocal microscopy

    • Super-resolution microscopy to visualize nanoscale interactions

    • Live-cell imaging with fluorescently tagged receptors and Syt3 to track dynamics

  • Molecular interaction studies:

    • Co-immunoprecipitation to detect physical association

    • Proximity ligation assays for in situ detection of protein interactions

    • FRET or BRET approaches to assess direct binding in living cells

  • Functional assessments:

    • Patch-clamp electrophysiology to measure AMPA receptor-mediated currents

    • Chemical LTD induction to trigger AMPA receptor internalization

    • Calcium imaging during receptor trafficking events

  • Perturbation experiments:

    • Expression of mutant Syt3 lacking calcium-binding ability

    • Competition with synthetic peptides derived from interaction domains

    • Acute inhibition using membrane-permeable inhibitors of endocytosis

These methodologies, when used in combination, can provide comprehensive insights into the mechanisms by which Syt3 regulates AMPA receptor trafficking in different neuronal populations and under various physiological conditions.

How can researchers reconcile contradictory findings regarding Synaptotagmin-3 localization?

The scientific literature contains some apparent discrepancies regarding Synaptotagmin-3 localization, with evidence supporting both presynaptic and postsynaptic presence. These seemingly contradictory findings can be reconciled through several considerations:

  • Technical factors:

    • Different detection methods have varying sensitivities and specificities

    • Biochemical fractionation detects Syt3 in both compartments

    • Immunohistochemistry may preferentially visualize locations with higher concentration

    • Antibody accessibility may differ between compartments

  • Biological variables:

    • Developmental regulation may alter Syt3 distribution at different stages

    • Cell-type specificity may result in variable localization patterns

    • Activity-dependent trafficking may redistribute Syt3 based on neuronal state

    • Multiple functional pools may exist simultaneously in different compartments

  • Integrative model:
    The data collectively supports a model where Syt3 is present in both presynaptic and postsynaptic compartments, with potentially different concentrations and functions:

    • Synaptosome analysis shows Syt3 in both VGLUT1-positive (presynaptic) and PSD-95-positive (postsynaptic) structures

    • Biochemical sub-fractionation confirms this dual localization

    • Functional studies demonstrate distinct roles in each compartment

Rather than viewing these findings as contradictory, researchers should recognize that Syt3's dual localization likely reflects its multifunctional role in coordinating presynaptic vesicle supply with postsynaptic receptor dynamics, potentially contributing to synaptic homeostasis mechanisms.

What experimental design considerations are crucial when studying Synaptotagmin-3 in memory processes?

When investigating Synaptotagmin-3's role in memory processes, researchers should consider several critical experimental design factors:

  • Task selection and design:

    • Include tasks specifically assessing forgetting and memory flexibility

    • The Morris water maze has successfully revealed Syt3 knockout effects on relearning

    • Incorporate reversal learning paradigms to test cognitive flexibility

    • Use tasks with varying cognitive demands to distinguish between memory formation, maintenance, and updating

  • Control conditions:

    • Include comprehensive controls for basic learning capacity

    • Test both short-term and long-term memory processes

    • Incorporate control tasks that don't rely on the same neural circuits

  • Molecular and cellular correlates:

    • Combine behavioral testing with ex vivo analysis of synaptic plasticity

    • Measure AMPA receptor trafficking in relevant brain regions following behavioral testing

    • Utilize in vivo calcium imaging during task performance when possible

  • Temporal considerations:

    • Implement longitudinal designs to capture both learning and forgetting phases

    • Include varied retention intervals to map the time course of Syt3's effects

    • Consider developmental timing when using genetic models

  • Rescue and intervention approaches:

    • Use temporally controlled genetic systems to distinguish between developmental and acute effects

    • Implement pharmacological interventions targeting Syt3-dependent pathways

    • Apply viral-mediated rescue in specific brain regions to establish causal relationships

By carefully addressing these design considerations, researchers can more precisely elucidate Syt3's role in the complex processes of memory formation, maintenance, and updating.

How can researchers differentiate between direct and indirect effects of Synaptotagmin-3 manipulation?

Distinguishing direct from indirect effects of Synaptotagmin-3 manipulation requires careful experimental design and interpretation:

  • Temporal resolution approaches:

    • Acute vs. chronic manipulation (e.g., conditional knockouts vs. germline deletion)

    • Rapid inhibition techniques (optogenetics or pharmacogenetics)

    • Time-course analysis of molecular events following Syt3 perturbation

  • Spatial resolution strategies:

    • Cell-type specific manipulation using Cre-driver lines

    • Local viral delivery to target specific brain regions

    • Subcellular targeting of interventions (e.g., targeting endocytic zones vs. synaptic vesicles)

  • Molecular specificity controls:

    • Structure-function analysis using domain-specific mutations

    • The C2B domain specifically affects oligomerization

    • C2B mutants that bind calcium but don't block oligomerization serve as important controls

    • Rescue experiments with wild-type vs. mutant forms

  • Pathway dissection:

    • Pharmacological isolation of specific signaling pathways

    • Combined manipulation of Syt3 and potential downstream effectors

    • In vitro reconstitution of minimal systems

  • Compensatory mechanism assessment:

    • Analysis of related synaptotagmin isoforms in Syt3 knockout models

    • Proteomics to identify upregulated compensatory proteins

    • Acute vs. developmental manipulation comparison to reveal compensation

What statistical approaches are most appropriate for analyzing complex Synaptotagmin-3 phenotypes?

Analyzing the complex phenotypes associated with Synaptotagmin-3 manipulation requires tailored statistical approaches:

For electrophysiological data:

  • Repeated measures ANOVA for analyzing responses over time or across stimulus frequencies

  • Mixed-effects models to account for both within-subject and between-subject factors

  • Non-parametric alternatives when normality assumptions are violated

  • Area-under-curve analysis for response magnitude over extended periods

For behavioral experiments:

  • ANOVA with appropriate post-hoc tests for multiple stage comparisons in learning tasks

  • Survival analysis techniques for latency measures

  • Repeated measures designs with appropriate corrections for sphericity violations

  • Path analysis for complex behavioral sequences

For molecular and cellular analyses:

  • Appropriate normalization strategies for Western blot quantification

  • Colocalization statistics (Pearson's correlation, Manders' overlap) for imaging data

  • Rigorous thresholding protocols for binary classification of positive/negative cells

  • Bootstrapping approaches for samples with limited biological replicates

General statistical considerations:

  • A priori power analysis to ensure adequate sample sizes

  • Blind analysis procedures to minimize experimenter bias

  • Correction for multiple comparisons to control Type I error rate

  • Reporting of effect sizes alongside p-values to indicate biological significance

  • Consideration of both statistical and biological significance in interpretation

What are the most promising therapeutic implications of Synaptotagmin-3 research?

Given Synaptotagmin-3's roles in memory processes and receptor trafficking, several therapeutic directions warrant investigation:

  • Memory disorders:

    • Syt3 modulation could potentially help with conditions characterized by perseverative memories

    • The impaired forgetting phenotype in Syt3 knockout mice suggests targeting Syt3 might enhance cognitive flexibility

    • Conditions involving maladaptive memories (PTSD, addiction) might benefit from enhanced Syt3 function

  • Synaptic plasticity disorders:

    • Neurodevelopmental conditions with altered plasticity may involve Syt3 dysfunction

    • The critical role of Syt3 in LTD suggests potential relevance to disorders with excitation/inhibition imbalance

    • Targeting Syt3-dependent AMPA receptor trafficking could provide a novel approach to modulating synaptic strength

  • Immune system modulation:

    • Syt3's essential function in T cell CXCR4 recycling suggests potential applications in immune disorders

    • Targeting Syt3 might influence T cell migration in inflammatory conditions

    • The specificity of Syt3 as the only synaptotagmin in T cells makes it an attractive target

These potential therapeutic applications require further investigation, beginning with more detailed mechanistic studies and proceeding through careful preclinical validation before clinical translation can be considered.

What key questions remain unresolved in Synaptotagmin-3 research?

Despite significant progress in understanding Synaptotagmin-3 function, several important questions remain:

  • Mechanistic questions:

    • What are the precise molecular interactions mediating Syt3's effects on AMPA receptor trafficking?

    • How does Syt3 coordinate with other endocytic machinery components?

    • What are the calcium-binding properties of Syt3 compared to other synaptotagmins?

    • How is Syt3 trafficking and function regulated by neuronal activity?

  • Physiological questions:

    • How does Syt3 contribute to different forms of learning and memory in vivo?

    • What is the relationship between Syt3's role in forgetting and its molecular function?

    • How do Syt3's presynaptic and postsynaptic functions coordinate during different activity patterns?

    • Does Syt3 function differently across brain regions and cell types?

  • Pathological questions:

    • Is Syt3 function altered in neurodevelopmental or neurodegenerative disorders?

    • Could Syt3 dysfunction contribute to memory disorders or conditions with cognitive inflexibility?

    • Are there human genetic variants in Syt3 associated with neuropsychiatric conditions?

Addressing these questions will require continued integration of molecular, cellular, and systems-level approaches to fully elucidate Syt3's multifaceted roles in neuronal function and behavior.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.