Recombinant Rat T-cell immunomodulatory protein (Itfg1)

Shipped with Ice Packs
In Stock

Description

General Information

ITFG1 is a protein associated with T-cell modulation and tissue integrity . The protein contains an Integrin-alpha FG-GAP repeat . ITFG1 has aliases including LINKIN and TIP and is encoded in humans by the gene ITFG1 .

Research Findings

  • T-Cell Modulation: ITFG1 is identified as a modulator of T-cell function, suggesting its involvement in immune response regulation .

  • Graft Versus Host Disease: ITFG1 has a protective effect in graft versus host disease models, indicating its potential therapeutic use in managing this condition .

  • Protein Interactions: Mass spectrometry analysis has identified proteins that interact with ITFG1, including RUVBL1. These interactions are enriched in cell networks involved in cell cycle, mitochondrial translation initiation, and regulation of DNA repair .

  • Tissue Integrity: ITFG1 is associated with proteins necessary for tissue integrity .

Functional Studies

  • Inhibition of T cell proliferation: Recombinant rat surfactant-associated protein D inhibits the lectin- and anti-CD3-stimulated proliferation of human PBMCs .

  • Impact on IL-2 Production: The addition of recombinant rat surfactant-associated protein D reduces the quantity of IL-2 detected in culture supernatants . The addition of rhIL-2 can restore the rate of proliferation .

  • Role in Autoimmune Disease: Recombinant human insulin-like growth factor-1 stimulates proliferation of both human and mouse regulatory T (Treg) cells and can control pathological responses in mouse models of autoimmune disease .

Table of ITFG1 Characteristics

CharacteristicDescription
Protein AliasesIntegrin-alpha FG-GAP repeat-containing protein 1, LINKIN, Protein TIP, T-cell immunomodulatory protein
Gene Aliases2310047C21Rik, CDA08, ITFG1, LNKN-1, TIP
FunctionModulator of T-cell function
Protective EffectHas a protective effect in graft versus host disease model
Ortholog IdentityMouse (87%), Rat (87%)
Interacting ProteinsRUVBL1 and other proteins involved in cell cycle, mitochondrial translation initiation, and regulation of DNA repair
Expressed inMDA-MB-231 breast cancer cells
ImmunogenicityImmunogenic, inducing proliferation of CD4+ and CD8+ T-cell subsets

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Itfg1; Cda08; Lnkn-1; Tip; T-cell immunomodulatory protein; Protein TIP; CDA08-like protein; Integrin-alpha FG-GAP repeat-containing protein 1; Linkin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
33-610
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Itfg1
Target Protein Sequence
LHNVTAELFGGEAWGTLAAFGDLNSDKQTDLFVLRERNDLIVFLADQSAPYFKPKVKVSL KNFSALVTSVVPGDYDGDSQMDVLLTYFPQNHSNNELGAVIFWGQNQTLDPKNMTILNRT FHDQPLIMDFNGDLIPDVFAITNESSQPQILLGGDLSWHPALTTKSKMRDPHSRAFIDLT EDFTADLFLTTLSASNTFQFEIWENLGGNFSIRSVFEKPKNLVVVGQSAFADFDGDGHMD HLLPGCEDKDCQKSAIYLMRSGTGQWAPVLQDSSNKGTLWGFVPFVHEERPTAIPVPLTL HIGDYNMDGYPDALAILKNTSGSNQQAFLLENVPCNNASCEEVHRMFKVYWDLAGLNLIK DAMVATFFDIYEDGTLDIIVLSKGYTKSDVAIHTLKNNFEADAYFVKVIVLSGLCSSDCP RKITPFGVNQPGPYIMYTTVDANGYLKNGSAGQLSQSAHLALQLPYNVLGLGRSANFLDH LFVGIPRPSGEKSIRKQEWTAIIPNSQLMVIPYPHSVPRSWSAKLYLTPSNIVLLTAVAL TGVCVFILAIIAILHWQEKKADDREKRQEAHRFHFDAM
Uniprot No.

Target Background

Function
Recombinant Rat T-cell immunomodulatory protein (Itfg1) is a modulator of T-cell function and exhibits a protective effect in graft-versus-host disease models.
Database Links
Protein Families
TIP family
Subcellular Location
Secreted. Cell membrane; Single-pass type I membrane protein.

Q&A

What is T-cell immunomodulatory protein (Itfg1) and what are its alternative names?

T-cell immunomodulatory protein (Itfg1) is a membrane protein that functions as a modulator of T-cell activity. It has a protective effect in graft versus host disease models and belongs to the TIP protein family. The protein is classified as an integral membrane protein that spans the cell membrane with portions exposed to both extracellular and intracellular environments. In terms of alternative nomenclature, Itfg1 is also known as Integrin alpha FG-GAP repeat-containing protein 1, Protein TIP, and in certain research contexts, it may be referred to by synonym gene names such as D8Wsu49e or Tip . In rat models specifically, Itfg1 may also be referred to as CDA08-like protein .

What are the structural characteristics of rat Itfg1 protein?

Rat T-cell immunomodulatory protein (Itfg1) is characterized by its amino acid sequence which contains multiple functional domains. The full-length protein spans amino acids 33-610 and includes several FG-GAP repeats characteristic of integrin alpha domains. The protein sequence contains regions for membrane anchoring as well as extracellular domains likely involved in cell-cell interactions or ligand binding. The primary structure of rat Itfg1 (UniProt accession: Q8R4E1) includes sections rich in leucine residues and contains multiple glycosylation sites that contribute to its tertiary structure and function . The protein's structural characteristics facilitate its localization to the plasma membrane, which has been confirmed in cellular models through subcellular fractionation and immunostaining techniques .

What cellular compartments is Itfg1 typically found in?

Itfg1 is primarily localized to the plasma membrane as an integral membrane protein. Subcellular fractionation studies using transfected MDA-MB-231 cells have demonstrated that Itfg1 is predominantly found in the membrane fraction. This localization is consistent regardless of whether the protein carries a C-terminal Myc tag, indicating that tagging does not interfere with proper subcellular targeting. Immunofluorescence microscopy has confirmed the plasma membrane distribution of Itfg1, and flow cytometry analysis has further validated its cell surface expression . In addition to the plasma membrane, Itfg1 is associated with the extracellular region, suggesting it may participate in cell-cell interactions or communication with the extracellular matrix .

What is the functional significance of Itfg1 in immune regulation?

Itfg1 serves as a critical modulator of T-cell function with significant implications for immune regulation. Research indicates that it has a protective effect in graft versus host disease models, suggesting its potential role in preventing excessive immune responses during tissue transplantation. As a membrane protein with extracellular domains, Itfg1 likely participates in cell-cell communications that regulate immune cell activity . The protein's involvement in T-cell modulation makes it a potential target for therapeutic interventions in conditions characterized by immune dysregulation. Studies investigating the protein interaction network of Itfg1 have revealed connections to proteins involved in various cellular processes, which may provide additional insights into its multifaceted roles in immune system regulation .

How does the recombinant production of rat Itfg1 differ from other species variants?

Recombinant production of rat Itfg1 requires specific considerations due to its unique amino acid sequence and post-translational modifications that may differ from human or mouse variants. The rat Itfg1 (UniProt: Q8R4E1) contains species-specific residues that necessitate optimized expression systems to ensure proper folding and functionality. When producing recombinant rat Itfg1, researchers must consider codon optimization for the chosen expression system, as well as the inclusion of appropriate signal peptides to facilitate membrane localization or secretion depending on the experimental design .

Compared to mouse Itfg1 (UniProt: Q99KW9), rat Itfg1 shares high sequence homology but contains distinct regions that may affect antibody recognition and interaction profiles. This necessitates species-specific validation of research tools and methodologies. Expression systems for rat Itfg1 typically require mammalian cell lines to ensure proper glycosylation and other post-translational modifications essential for protein function, whereas bacterial expression systems may be sufficient for producing certain domains of the protein for structural studies .

What protein-protein interactions has Itfg1 been shown to participate in, and what methodologies best capture these interactions?

Itfg1 has been demonstrated to interact with several proteins, most notably RUVBL1, through comprehensive protein interaction studies. This interaction was initially identified and subsequently validated in breast cancer cell line models, where it has been implicated in metastatic processes. Research employing immunoprecipitation coupled with mass spectrometry has confirmed this interaction, showing significant enrichment of RUVBL1 (26.8-fold in transient and 6.09-fold in stable Itfg1-expressing cells) compared to control cells .

Beyond RUVBL1, unbiased mass spectrometry-based proteomics has identified numerous potential Itfg1 interactors. Studies utilizing both transient and stable ITFG1-expressing cells identified 1756 and 373 potential interacting proteins, respectively, with 180 proteins identified across both experimental setups. Among these, functional studies in C. elegans have highlighted the importance of interactions with orthologs of ATP9A/tat-5, NME1/ndk-1, and ANAPC2/apc-2, as their loss-of-function exhibited migratory detachment phenotypes similar to LINKIN (the C. elegans ortholog of Itfg1) .

To effectively capture these interactions, researchers have employed multiple complementary approaches:

  • Co-immunoprecipitation with epitope-tagged Itfg1 followed by mass spectrometry

  • Reciprocal co-immunoprecipitation with tagged interacting partners (e.g., FLAG-RUVBL1)

  • Validation through immunoblotting of immunoprecipitated complexes

  • Functional validation through orthologous gene studies in model organisms

How do post-translational modifications affect the function and localization of Itfg1?

Post-translational modifications (PTMs) play crucial roles in determining Itfg1's functionality and subcellular localization, though this area remains less thoroughly characterized compared to other aspects of Itfg1 biology. As an integral membrane protein with multiple extracellular domains, Itfg1 is subject to glycosylation, which likely contributes to its proper folding, trafficking to the plasma membrane, and interaction with binding partners.

Mass spectrometry analyses of immunoprecipitated Itfg1 have revealed protein bands of various molecular weights (between 75-150 kDa and 37-75 kDa), suggesting the presence of different post-translationally modified forms of the protein . These different molecular weight species may represent varying glycosylation states or other modifications that affect protein mobility in gel electrophoresis.

The membrane localization of Itfg1 suggests that lipid modifications may also contribute to its anchoring and distribution within membrane microdomains. Understanding these modifications is essential when designing experiments with recombinant Itfg1, as expression systems must be capable of performing the relevant PTMs to produce functionally equivalent protein .

What is the role of Itfg1 in cellular adhesion and migration based on current research?

Research suggests that Itfg1 plays a significant role in cellular adhesion and migration processes. Studies in C. elegans have shown that loss of function of LINKIN (the ortholog of Itfg1) results in migratory detachment phenotypes, indicating its importance in maintaining cell-cell or cell-matrix adhesions during migration. This finding is particularly relevant in the context of the ITFG1-RUVBL1 interaction, which has been implicated in metastatic processes in breast cancer models .

The localization of Itfg1 to the plasma membrane positions it perfectly to participate in adhesion complexes. Its identification as an integrin alpha FG-GAP repeat-containing protein further supports a potential role in adhesion, as these domains are commonly found in proteins involved in cell adhesion processes .

Experimental evidence from breast cancer cell lines demonstrates that Itfg1 interacts with proteins involved in membrane dynamics and cytoskeletal organization. For instance, the interaction with ATP9A/tat-5 (a phospholipid flippase) suggests a role in membrane asymmetry maintenance, which is critical for proper cell adhesion and migration. Similarly, interactions with proteins involved in nuclear dynamics and cell cycle regulation (such as RUVBL1 and cohesion/condensin components) hint at complex regulatory networks connecting adhesion, migration, and cellular division .

What expression systems are most suitable for producing recombinant rat Itfg1?

For producing recombinant rat Itfg1 with proper folding and post-translational modifications, mammalian expression systems are generally preferred due to their capacity to perform complex glycosylation and proper disulfide bond formation. Chinese Hamster Ovary (CHO) cells and Human Embryonic Kidney 293 (HEK293) cells have been successfully used for the expression of membrane proteins like Itfg1. For rat Itfg1 specifically, these systems can be optimized using:

  • Codon optimization for enhanced expression in the chosen host

  • Inclusion of appropriate signal peptides for membrane targeting

  • Selection of tags (such as Myc or FLAG) that do not interfere with protein localization or function

For structural studies requiring larger protein quantities, insect cell expression systems (such as Sf9 or Hi5 cells with baculovirus vectors) may provide higher yields while maintaining most post-translational modifications. Bacterial systems such as E. coli are generally less suitable for full-length Itfg1 due to the lack of glycosylation machinery, but may be employed for expressing specific domains for structural or interaction studies .

When selecting an expression system, researchers should consider the downstream application requirements. For functional studies, preservation of native structure and post-translational modifications is critical, whereas for antibody generation or certain binding assays, bacterial expression of specific domains may be sufficient .

What purification strategies yield the highest purity and functional integrity for recombinant Itfg1?

Purification of recombinant rat Itfg1 requires careful consideration of its membrane protein nature and the need to maintain functional integrity. A multi-step purification strategy typically yields the best results:

  • Membrane fraction isolation: Initially separate the membrane fraction from cell lysates using ultracentrifugation to enrich for Itfg1.

  • Detergent solubilization: Carefully select appropriate detergents such as n-dodecyl-β-D-maltoside (DDM), Triton X-100, or CHAPS to solubilize Itfg1 while preserving its native conformation.

  • Affinity chromatography: Utilize tags incorporated during recombinant expression (His, FLAG, or Myc) for initial capture. For the rat Itfg1 with a Myc tag, anti-Myc agarose affinity gels have proven effective in co-immunoprecipitation studies .

  • Size exclusion chromatography: Further purify the protein and remove aggregates or oligomers that may affect functional studies.

  • Ion exchange chromatography: As a polishing step to remove remaining contaminants based on charge differences.

Throughout the purification process, it's crucial to maintain buffer conditions that preserve protein stability, potentially including glycerol (typically at 50%), protease inhibitors, and appropriate pH levels. For functional studies, reconstitution into liposomes or nanodiscs may be necessary to provide a membrane-like environment that maintains protein conformation and activity .

How can Itfg1-protein interactions be effectively validated using complementary techniques?

Validation of Itfg1 protein interactions requires multiple complementary approaches to establish confidence in the findings. Based on successful studies with Itfg1 and RUVBL1, the following multi-tiered validation strategy is recommended:

Tier 1: Initial Identification

  • Co-immunoprecipitation coupled with mass spectrometry: Using epitope-tagged Itfg1 (e.g., Itfg1-Myc) to pull down interacting partners, followed by mass spectrometry identification. This approach has successfully identified numerous potential Itfg1 interactors .

Tier 2: Biochemical Validation

  • Reciprocal co-immunoprecipitation: Express tagged versions of identified interacting partners (e.g., FLAG-RUVBL1) and perform reverse pull-downs to confirm bidirectional interaction .

  • Immunoblotting: Validate specific interactions by probing immunoprecipitates with antibodies against the proteins of interest.

  • Proximity ligation assay (PLA): Visualize protein interactions in situ within cells.

Tier 3: Functional Validation

  • Orthologous gene studies: Examine loss-of-function phenotypes in model organisms such as C. elegans, as demonstrated with ATP9A/tat-5, NME1/ndk-1, and ANAPC2/apc-2 .

  • Co-localization studies: Confirm that interacting proteins occupy the same subcellular compartments using confocal microscopy.

  • Functional assays: Develop assays that measure biological outcomes dependent on the interaction.

Tier 4: Biophysical Characterization

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI): Determine binding kinetics and affinity constants.

  • Isothermal Titration Calorimetry (ITC): Measure thermodynamic parameters of the interaction.

This multi-tiered approach has been successfully employed to validate the Itfg1-RUVBL1 interaction, where initial mass spectrometry findings showed enrichment factors of 26.8-fold and 6.09-fold in transient and stable expression systems, respectively, followed by confirmation through reciprocal co-immunoprecipitation and immunoblotting .

What considerations are important when designing antibodies against rat Itfg1 for research applications?

When designing antibodies against rat Itfg1 for research applications, several key considerations must be addressed to ensure specificity, sensitivity, and application versatility:

1. Epitope Selection:

  • Target unique regions of rat Itfg1 that differ from mouse or human orthologs to ensure species specificity

  • Consider both extracellular domains (for cell surface detection) and intracellular domains (for Western blotting and immunoprecipitation)

  • Avoid highly glycosylated regions which may interfere with antibody recognition

  • The amino acid sequence provided in search result can guide epitope selection, focusing on regions with high antigenicity and surface accessibility

2. Antibody Format:

  • Monoclonal antibodies offer consistency and specificity for detailed characterization studies

  • Polyclonal antibodies may provide higher sensitivity for detection of low-abundance Itfg1

  • Consider developing antibodies against different epitopes for confirmation of results through multiple antibodies

3. Validation Requirements:

  • Validate using both recombinant protein and endogenous Itfg1 expression systems

  • Confirm specificity using knockout/knockdown controls

  • Test across multiple applications (Western blot, immunoprecipitation, immunofluorescence, flow cytometry)

  • Validate subcellular localization patterns match expected membrane distribution

4. Application-Specific Considerations:

  • For flow cytometry or immunofluorescence of non-permeabilized cells, target extracellular epitopes

  • For co-immunoprecipitation studies, select antibodies that don't interfere with known protein interaction domains

  • For functional studies, determine whether antibodies have neutralizing activity

5. Tag Compatibility:

  • Ensure compatibility with common tags (Myc, FLAG) if working with recombinant systems

  • Develop strategies to distinguish between endogenous and recombinant tagged Itfg1

How should mass spectrometry data for Itfg1 interaction studies be analyzed and filtered to minimize false positives?

Analysis of mass spectrometry data for Itfg1 interaction studies requires rigorous filtering strategies to distinguish genuine interactors from background contaminants. Based on successful approaches used in Itfg1-RUVBL1 interaction studies, the following analytical framework is recommended:

1. Experimental Design for Robust Analysis:

  • Include appropriate negative controls (non-transfected cells, cells expressing tag-only constructs)

  • Perform both transient and stable expression experiments when possible to identify consistent interactors

  • Implement biological replicates (minimum of two independent experiments, as demonstrated in the ITFG1 research)

2. Primary Filtering Criteria:

  • Apply fold-enrichment thresholds relative to control samples (e.g., the 26.8-fold enrichment observed for RUVBL1 in transient expression studies)

  • Establish minimum peptide count and protein coverage requirements

  • Filter based on statistical significance (p-value) of enrichment

3. Secondary Filtering Based on Biological Context:

  • Prioritize proteins identified in both transient and stable expression systems (as demonstrated by the 180 proteins identified in both systems in the ITFG1 studies)

  • Consider subcellular localization compatibility (membrane-associated proteins for Itfg1)

  • Evaluate biological plausibility based on known functions and pathways

4. Contaminant Database Comparison:

  • Cross-reference with common mass spectrometry contaminant databases

  • Compare with control immunoprecipitations using unrelated bait proteins

5. Network Analysis Approaches:

  • Implement clustering algorithms to identify protein complexes

  • Perform GO term enrichment analysis to identify overrepresented functional categories

  • Construct protein-protein interaction networks to visualize relationship patterns

6. Validation Planning:

  • Prioritize candidates for validation based on enrichment scores, biological relevance, and availability of reagents

  • Design orthogonal validation experiments based on top candidates (as demonstrated with the C. elegans ortholog studies for ATP9A/tat-5, NME1/ndk-1, and ANAPC2/apc-2)

This structured approach has proven effective in identifying genuine Itfg1 interactors while minimizing false positives, as evidenced by the successful validation of multiple interaction partners in follow-up studies .

What statistical approaches are most appropriate when analyzing phenotypic effects of Itfg1 in cellular and animal models?

For Cell-Based Assays:

  • Cell Surface Expression Analysis (Flow Cytometry):

    • Employ non-parametric tests (Mann-Whitney U) for comparing median fluorescence intensity between control and Itfg1-expressing cells

    • Utilize Kolmogorov-Smirnov tests to compare distribution shapes of expression levels

    • Present data as histograms with statistical significance indicators

  • Protein Interaction Quantification:

    • For immunoprecipitation followed by immunoblotting, use densitometry with normalization to input levels

    • Apply paired t-tests or Wilcoxon signed-rank tests for comparing multiple experimental repeats

    • For mass spectrometry quantification, employ specialized statistical packages that account for the unique characteristics of proteomic data

  • Cell Migration and Adhesion Assays:

    • Use ANOVA with appropriate post-hoc tests for multi-condition comparisons

    • Apply linear mixed-effects models when analyzing time-course data with repeated measures

    • Consider survival analysis approaches (Kaplan-Meier) for time-to-detachment studies

For Animal Models:

  • Phenotypic Analysis in C. elegans:

    • Implement logistic regression for binary outcome phenotypes (e.g., presence/absence of migratory detachment)

    • Use Chi-square or Fisher's exact tests for categorical comparisons between wild-type and mutant populations

    • Apply non-parametric tests for quantitative traits that may not follow normal distributions

  • Tissue-Level Effects:

    • Employ hierarchical/nested statistical designs that account for multiple measurements from the same animal

    • Use power analysis to determine appropriate sample sizes based on expected effect magnitudes

General Considerations:

This comprehensive statistical approach ensures robust analysis of phenotypic effects related to Itfg1 function across different experimental systems .

How can researchers effectively compare Itfg1 sequence and functional conservation across species?

Effective comparison of Itfg1 sequence and functional conservation across species requires a multi-dimensional approach combining bioinformatic analysis with experimental validation. The following framework provides a systematic method for cross-species Itfg1 analysis:

1. Sequence Alignment and Structural Analysis:

  • Perform multiple sequence alignment of Itfg1 proteins from key species (human, rat, mouse, C. elegans LINKIN) using tools such as Clustal Omega or MUSCLE

  • Generate phylogenetic trees to visualize evolutionary relationships

  • Calculate percent identity and similarity matrices across species

  • Map conserved domains, focusing on the integrin alpha FG-GAP repeats characteristic of Itfg1

2. Domain Conservation Analysis:

DomainRat Itfg1 (Q8R4E1)Mouse Itfg1 (Q99KW9)Human ITFG1C. elegans LINKINConservation Level
Signal PeptideAA 1-32AA 1-32AA 1-31PresentHigh
FG-GAP Repeat 1AA 33-124AA 33-124AA 32-123PresentHigh
FG-GAP Repeat 2AA 125-216AA 125-216AA 124-215PresentHigh
Membrane-spanningAA 580-602AA 580-602AA 579-601PresentHigh
Cytoplasmic TailAA 603-610AA 603-610AA 602-612PresentModerate

3. Functional Motif Analysis:

  • Identify conserved phosphorylation sites, glycosylation sites, and protein interaction motifs

  • Employ tools such as NetPhos, NetNGlyc, and ELM (Eukaryotic Linear Motif) resource

  • Correlate conservation patterns with known functional data

4. Cross-Species Complementation Experiments:

  • Design rescue experiments where orthologs from different species are expressed in model systems with Itfg1/LINKIN deficiency

  • Assess the ability of rat Itfg1 to rescue phenotypes in C. elegans linkin mutants or human cell lines with ITFG1 knockdown

  • Quantify rescue efficiency to determine functional equivalence across species

5. Interactome Conservation Analysis:

  • Compare protein interaction networks of Itfg1 across species

  • Identify conserved interaction partners (such as RUVBL1) as core functional components

  • Analyze species-specific interactions that may reflect specialized functions

  • Construct interaction conservation maps highlighting preserved and divergent protein partnerships

6. Expression Pattern Comparison:

  • Compare tissue and cellular expression patterns of Itfg1 across species using transcriptomic databases

  • Identify conserved regulatory elements in promoter regions

  • Correlate expression patterns with known phenotypes in different model organisms

This comprehensive approach allows researchers to move beyond sequence homology to establish functional conservation of Itfg1 across species, providing crucial context for translating findings between model systems and human studies .

What are the major research gaps and future directions in Itfg1 research?

The current landscape of Itfg1 research reveals several significant knowledge gaps and promising future directions that merit investigation. Based on the available literature, the following areas represent critical opportunities for advancing our understanding of this important immunomodulatory protein:

Structural Biology Gaps:

  • No high-resolution crystal or cryo-EM structure of full-length Itfg1 is currently available

  • The precise membrane topology and structural transitions during signaling remain uncharacterized

  • The structural basis for Itfg1 interactions with partners like RUVBL1 needs elucidation

Functional Understanding Gaps:

  • The precise molecular mechanisms by which Itfg1 modulates T-cell function remain incompletely understood

  • The role of Itfg1 in non-immune tissues requires further characterization

  • The signaling pathways downstream of Itfg1 activation need comprehensive mapping

  • The functional significance of the interaction between Itfg1 and cohesion/condensin components suggests unexplored connections to chromatin dynamics and cell division

Translational Research Opportunities:

  • The protective effect of Itfg1 in graft versus host disease models warrants deeper investigation for potential therapeutic applications

  • The involvement of Itfg1-RUVBL1 interaction in metastasis suggests opportunities for cancer therapy research

  • The development of Itfg1-targeting agents (antibodies, small molecules) as potential immunomodulatory therapeutics

Technical Development Needs:

  • Improved tools for studying endogenous Itfg1, including better antibodies and reporter systems

  • Development of inducible, tissue-specific knockout models to study Itfg1 function in complex organisms

  • High-throughput screening approaches to identify modulators of Itfg1 function or interaction

To address these gaps, interdisciplinary approaches combining structural biology, proteomics, genetic models, and translational research will be essential. The continued exploration of Itfg1 biology promises to yield important insights into fundamental immune regulatory mechanisms and potential therapeutic opportunities for immune-related disorders and cancer .

How can researchers optimize experimental design when working with recombinant rat Itfg1?

Optimizing experimental design when working with recombinant rat Itfg1 requires careful consideration of multiple factors to ensure reliable, reproducible, and physiologically relevant results. Based on successful approaches documented in the literature, the following optimization framework is recommended:

Expression System Selection:

  • Choose mammalian expression systems (CHO, HEK293T) for studies requiring full post-translational modifications

  • Consider stable cell lines for consistent expression levels across experiments

  • Validate that the expressed protein localizes correctly to the plasma membrane using subcellular fractionation and immunostaining

Tagging Strategy Optimization:

  • Use C-terminal tags (Myc, FLAG) which have been demonstrated not to interfere with Itfg1 membrane localization

  • Implement tag removal options (TEV protease sites) for studies where the tag might interfere

  • Consider dual tagging strategies for orthogonal purification approaches

Control Implementation:

  • Include multiple appropriate controls in all experiments:

    • Non-transfected cells for background assessment

    • Tag-only expressing cells to control for tag-specific effects

    • Scrambled/mutant Itfg1 variants as functional controls

Functional Assay Design:

  • Develop quantitative readouts for Itfg1 function based on known biology:

    • T-cell modulation assays measuring activation markers or cytokine production

    • Cell adhesion and migration assays to assess involvement in these processes

    • Protein interaction assays with known partners like RUVBL1

Validation Across Models:

  • Confirm key findings using both overexpression and endogenous systems

  • Validate results in primary cells when possible, not just cell lines

  • Consider validation in orthologous systems (e.g., C. elegans LINKIN) for evolutionary conservation

Data Integration Approach:

  • Combine multiple methodologies to build comprehensive understanding:

    • Biochemical approaches (co-IP, pull-downs)

    • Imaging techniques (confocal microscopy, FRET)

    • Functional assays (migration, adhesion)

    • -omics approaches (proteomics, transcriptomics)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.