Recombinant Rat T-cell surface antigen CD2 (Cd2)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Immune Biology

Recombinant Rat CD2 mimics native CD2’s dual roles:

Adhesion and Co-Stimulation

  • Primary Ligands: Binds CD48 (rodent-specific) or LFA-3 (CD58 in humans) to mediate T cell-antigen-presenting cell (APC) adhesion .

  • Co-Stimulatory Role: Enhances T cell activation when paired with TCR/peptide-MHC interactions, lowering the antigen recognition threshold .

Signaling Pathways

The cytoplasmic tail interacts with:

  • Kinases: Lck, Fyn .

  • Adaptor Proteins: CD2BP2, PSTPIP1, CD2AP .

Research Applications

Recombinant Rat CD2 is widely used in:

ApplicationMethodPurposeSource
ELISASandwich ELISA for quantifying CD2 in serum/plasma/cell culturesDiagnosing immune disorders (autoimmune diseases, cancer)
Functional StudiesBinding assays with CD48/CD58; T cell activation assaysMapping ligand interactions; studying T cell signaling
Therapeutic DevelopmentTargeting CD2 with monoclonal antibodies (e.g., alefacept)Modulating T cell responses in autoimmune diseases or transplant rejection

CD2 Deficiency in Rodent Models

  • Thymic Development: CD2-deficient mice show pre-TCR signaling defects, leading to impaired thymocyte maturation .

  • Antigen Responsiveness: T cells require 3–10× higher peptide concentrations for activation, highlighting CD2’s role in threshold regulation .

Species-Specific Differences

SpeciesLigandAffinityFunctional ImpactSource
RatCD48Lower affinity than human CD58Quantitative defect in T cell activation
HumanCD58Higher affinity (~5–10×)Enhanced synapse organization in memory T cells

Role in Immunological Synapse Formation

  • Pre-Synapse Formation: CD2 is enriched in the T cell uropod during APC scanning, facilitating initial contact .

  • Pathogen Evasion: Viruses like HCMV downregulate LFA3 to evade CD2-dependent cytotoxicity .

Therapeutic Potential

  • Targeting Memory T Cells: CD2 is upregulated on memory T cells, making it a selective target for autoimmune therapies (e.g., alefacept) .

  • Combination Therapies: CD2 blockade synergizes with TCR/CD3 inhibitors to modulate immune responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary based on your purchasing method and location. For specific delivery estimates, kindly consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid protein exhibits a shelf life of 6 months at -20°C/-80°C. Lyophilized protein has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Cd2; T-cell surface antigen CD2; LFA-2; LFA-3 receptor; OX-34 antigen; T-cell surface antigen T11/Leu-5; CD antigen CD2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-344
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Cd2
Target Protein Sequence
RDSGTVWGALGHGINLNIPNFQMTDDIDEVRWERGSTLVAEFKRKMKPFLKSGAFEILANGDLKIKNLTRDDSGTYNVTVYSTNGTRILDKALDLRILEMVSKPMIYWECSNATLTCEVLEGTDVELKLYQGKEHLRSLRQKTMSYQWTNLRAPFKCKAVNRVSQESEMEVVNCPEKGLPLYLIVGVSAGGLLLVFFGALFIFCICKRKKRNRRRKGEELEIKASRMSTVERGPKPHSTQASAPASQNPVASQAPPPPGHHLQTPGHRPLPPSHRNREHQPKKRPPPSGTQVHQQKGPPLPRPRVQPKPPCGSGDVSLPPPN
Uniprot No.

Target Background

Function
CD2, a T-cell surface antigen, interacts with lymphocyte function-associated antigen CD58 (LFA-3) and CD48/BCM1 to mediate cell adhesion between T-cells and other cell types. Its involvement in T-cell activation is notable, and the cytoplasmic domain plays a critical role in signaling functions.
Gene References Into Functions
  1. At temperatures exceeding approximately 68 degrees C, a partially folded state of CD2-1 (H state) is observed. This state features a distinct secondary structure, characterized by largely exposed aromatic and hydrophobic residues, and a significantly altered tertiary structure. PMID: 11939369
  2. Structural biology of the cell adhesion protein CD2: alternatively folded states and structure-function relation. Review. PMID: 12369898
  3. Research indicates that designed cyclic peptides with beta-turn structure can modulate the CD2-CD58 interaction, which is crucial for an immune response. PMID: 15233784
Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is rat CD2 and what cellular populations express it?

Rat CD2, also known as T-cell surface antigen T11/Leu-5 or SRBC, is a single-pass type I membrane protein expressed predominantly on T lymphocytes and natural killer (NK) cells. The protein contains one Ig-like C2-type domain and one Ig-like V-type domain, forming part of the immunoglobulin superfamily of cell adhesion molecules . Its structure includes extracellular, transmembrane, and cytoplasmic domains that collectively participate in both adhesion and signaling functions. CD2 serves as a cell adhesion molecule that mediates interactions between T cells and other cell types, including antigen-presenting cells and target cells . The extracellular portion consists of approximately 202 amino acids (Met1-Pro202), making it an accessible target for antibody-based detection and functional studies .

What are the principal ligands for rat CD2 and how do they differ from human ligands?

The principal ligand for rat CD2 is CD48, which differs from the human system where CD58 (lymphocyte function-associated antigen 3, LFA-3) serves as the primary binding partner. This species-specific difference in ligand preference represents an important consideration when translating research findings between rodent models and human applications . The rat CD2-CD48 interaction is characterized by a relatively low affinity binding with a dissociation constant (Kd) of approximately 60-90 μM at 37°C, as determined by surface plasmon resonance and analytical ultracentrifugation studies . Interestingly, the human CD2-CD58 interaction demonstrates a 5-10 fold greater solution affinity than the mouse or rat CD2-CD48 interaction, with the difference in physiologically relevant "two-dimensional" affinity being even greater at 40-50 fold . These affinity differences suggest that studies in rodent models may actually underestimate the contribution of CD2 to T cell function in humans.

How does CD2 contribute to T-cell activation and immune responses?

CD2 plays a quantitative role in enhancing T cell antigen recognition, enabling T cells to respond to lower concentrations of antigens. Studies with CD2-deficient mice have demonstrated that T cells require 3-10 fold higher concentrations of peptide to produce equivalent responses compared to wild-type T cells . This enhancement appears particularly significant when T cells encounter low density or low affinity peptide-MHC complexes, suggesting CD2 has evolved to amplify T cell sensitivity across a broader range of antigenic stimuli . The mechanism involves positioning the membranes of T cells and antigen-presenting cells at an optimal separation distance (approximately 14 nm) for TCR engagement with peptide-MHC complexes, forming what researchers term "close contact zones" . Additionally, CD2 contributes to the formation and maintenance of the immunological synapse, redistributing to the inner adhesion ring following initial TCR triggering .

What expression systems are optimal for producing functional recombinant rat CD2?

Mammalian expression systems are generally preferred for producing functional recombinant rat CD2, as they provide appropriate post-translational modifications essential for proper folding and activity. Human cell lines have been successfully employed to express recombinant rat CD2, often utilizing fusion constructs with the Fc region of human IgG1 at the C-terminus to facilitate purification and detection . When designing expression constructs, researchers typically encode the extracellular portion of rat CD2 (Met1-Pro202) to eliminate the transmembrane domain, thereby creating a soluble version of the protein . Alternative expression strategies include transient expression in COS7 cells, which has proven effective for co-expression studies investigating molecular interactions between CD2 and other T cell surface molecules like CD5 . For studies requiring stable expression, Jurkat cell transfection has been demonstrated as a viable approach, particularly when investigating chimeric proteins containing different domains of CD2 .

What methods can be used to verify the proper folding and biological activity of recombinant rat CD2?

Several complementary approaches can be employed to verify proper folding and biological activity of recombinant rat CD2. SDS-PAGE analysis under reducing conditions typically reveals a monomeric protein of approximately 47.5 kDa, though the apparent molecular mass may appear larger (58-64 kDa) due to glycosylation . Functional verification often involves binding assays with natural ligands like CD48 or specific monoclonal antibodies with known epitope specificity, such as MRC OX-54, MRC OX-55, MRC OX-34, and MRC OX-53 . Surface plasmon resonance provides a sensitive method to quantify binding kinetics and affinities, though researchers should be aware that immobilization might affect the measured parameters . Analytical ultracentrifugation offers an alternative approach for studying interactions in free solution without requiring immobilization, with sedimentation equilibrium being particularly useful for low-affinity interactions like CD2-CD48 . Biological activity can be further validated through T cell proliferation assays, where properly folded CD2, when engaged by appropriate antibody pairs, should induce T cell activation and proliferation in the presence of accessory cells .

What approaches are most effective for studying CD2 associations with other T cell surface molecules?

Several complementary techniques have proven effective for investigating CD2 associations with other T cell surface molecules. Co-immunoprecipitation remains a fundamental approach, with quantification methods revealing that CD5 represents the antigen capable of co-precipitating the largest proportion of CD2 in rat T lymphocytes . Co-capping assays provide a visualization method to observe molecular associations at the cell surface, complementing biochemical approaches with spatial information . For investigating direct protein-protein interactions, co-expression of CD2 and potential binding partners in heterologous systems like COS7 cells, followed by co-immunoprecipitation, can determine whether associations require additional lymphocyte-specific factors . The creation of chimeric proteins containing different domains of CD2 helps map interaction interfaces, as demonstrated in studies showing that both the extracellular and cytoplasmic domains of CD2 interact with CD5, while the transmembrane domain is not involved . Advanced imaging techniques like FRET (Fluorescence Resonance Energy Transfer) could further enhance detection of molecular proximity in living cells, though this approach was not specifically mentioned in the search results.

What controls are necessary when designing experiments with recombinant rat CD2?

When designing experiments with recombinant rat CD2, several key controls are essential for rigorous interpretation. For binding studies, specificity controls should include irrelevant proteins of similar size and structure to ensure observed interactions are not due to non-specific effects . When using antibody pairs to stimulate T cells via CD2, researchers should include individual antibodies with crosslinking secondary antibodies to demonstrate that the observed effect requires engagement of distinct epitopes rather than simply crosslinking of the molecule . The search results indicate that phorbol ester PMA cannot replace either antibody in CD2-mediated T cell activation assays, suggesting that appropriate positive controls for T cell activation (like direct TCR stimulation) should be included alongside CD2-specific interventions . For recombinant protein production, quality control measures should include SDS-PAGE analysis under both reducing and non-reducing conditions, as the recombinant rat CD2/Fc is typically a disulfide-linked homodimer . When studying CD2 associations with other molecules like CD5, controls should include antibodies against unrelated surface molecules to demonstrate specificity of the observed interactions .

How should researchers interpret differences between in vitro and in vivo findings regarding CD2 function?

The interpretation of differences between in vitro and in vivo findings regarding CD2 function requires careful consideration of several factors. Bachmann et al. observed that while CD2-deficient mice showed clear quantitative defects in T cell antigen recognition in vitro, previous studies had found no abnormalities in T cell function in initial experiments with these mice . This apparent discrepancy was resolved through more sensitive in vivo assays comparing the expansion of CD2-deficient and CD2-sufficient TCR-transgenic T cells after viral challenge . The results revealed that CD2 only conferred an advantage to T cells when antigenic levels were limiting, as occurred with inactivated virus or viral protein, but not with replication-competent virus that would generate abundant antigen . These findings illustrate the importance of considering antigen availability and persistence when translating between in vitro and in vivo systems. Additionally, the search results highlight significant differences in CD2-ligand binding affinities between species, with human interactions being substantially stronger than rodent equivalents, suggesting that mouse studies may underestimate CD2's importance in human immune function . When interpreting experimental results, researchers should also consider that the subtle quantitative effects of CD2 on T cell activation may become more pronounced when examining responses to weak or limited antigens rather than optimal stimulation conditions.

What are the key methodological challenges in measuring CD2-CD48 interactions?

Measuring the interaction between CD2 and CD48 presents several methodological challenges due to its low affinity nature. The reported dissociation constant (Kd) of 60-90 μM at 37°C indicates a weak interaction that may be difficult to detect using conventional binding assays . Surface plasmon resonance measurements can be affected by the immobilization of ligands on sensor chips, potentially altering binding properties or promoting self-association artifacts . To overcome these limitations, researchers have employed analytical ultracentrifugation procedures that allow the interaction to be studied in free solution without immobilization media . Sedimentation equilibrium analysis has proven particularly useful for characterizing this low-affinity interaction . Another significant challenge is translating solution-phase measurements to the physiologically relevant two-dimensional interaction at cell-cell contacts, where the restricted orientation and increased local concentration may substantially enhance effective binding . The multivalent nature of cell-cell interactions adds further complexity, as multiple CD2-CD48 bonds likely form simultaneously during T cell-APC contacts, creating avidity effects that are difficult to recapitulate in soluble protein studies .

What approaches can be used to study the dynamics of CD2 in the immunological synapse?

The dynamics of CD2 in the immunological synapse can be studied through various complementary approaches. The search results indicate that CD2 redistributes to the inner adhesion ring of the immunological synapse following initial TCR triggering, suggesting that live-cell imaging techniques tracking fluorescently labeled CD2 would be valuable for studying this process . TCR downmodulation correlates with receptor engagement and can serve as a proxy measure for CD2's effect on TCR-peptide-MHC interactions . The dimensional properties of CD2-ligand complexes appear critical for T cell activation, as evidenced by studies showing that elongated CD2-CD48 interactions (>21 nm) inhibit T cell antigen recognition below levels seen in the complete absence of CD2-CD48 . This suggests that precise manipulation of the CD2-ligand complex dimensions, perhaps through engineered recombinant proteins with modified domain structures, could provide insights into the spatial requirements of immunological synapse formation. The search results also indicate that CD2 may have dual functions: initial membrane approximation to enhance TCR triggering, followed by participation in the molecular filtering that maintains synapse structure . Time-resolved studies examining these distinct phases would help illuminate CD2's dynamic contributions to immunological synapse formation and maintenance.

How do differences between rat and human CD2 impact experimental design and interpretation?

The significant differences between rat and human CD2 systems necessitate careful consideration in experimental design and data interpretation. Human CD2 binds its major ligand, CD58, with 5-10 fold greater solution affinity than rat or mouse CD2 binds to CD48, with the physiologically relevant "two-dimensional" affinity difference being even greater at 40-50 fold . This substantial affinity differential means that observations in rat models likely underestimate the contribution of CD2 to T cell function in humans . When designing experiments using recombinant rat CD2 with the intention of extrapolating to human systems, researchers should account for these quantitative differences rather than assuming equivalent contributions to T cell activation. The search results indicate that both rat and human CD2 interact with their respective ligands in a head-to-head orientation spanning approximately 14 nm, suggesting structural conservation of the binding interface despite ligand differences . This conserved spatial arrangement provides a foundation for comparative studies examining the consequences of the affinity differences. Researchers should also consider that while CD2-deficient mice show subtle phenotypes, the higher affinity of human CD2-CD58 interactions might translate to more pronounced effects in human systems, potentially affecting the interpretation of therapeutic interventions targeting CD2.

What experimental systems best model human CD2 function using rat recombinant proteins?

Despite species differences, several experimental approaches can optimize the relevance of rat CD2 studies to human systems. Quantitative assays measuring the threshold of antigen required for T cell activation, rather than binary activation outcomes, may better capture the enhancing effect of CD2 that appears conserved across species despite affinity differences . The search results indicate that CD2's function in positioning cell membranes at an optimal distance for TCR-peptide-MHC engagement is likely a fundamental mechanism conserved between rats and humans . Therefore, experimental systems focusing on this membrane-approximation role, such as supported lipid bilayers incorporating recombinant proteins at controlled densities, may provide insights applicable across species. Co-expression studies examining the molecular associations of CD2, such as its interaction with CD5 observed in rat T lymphocytes, might identify conserved protein-protein interactions that maintain similar functional outcomes despite receptor-ligand affinity differences . For more direct translation, humanized mouse models expressing human CD2 and CD58 could provide an improved system for studying the human interaction in vivo, though this approach was not specifically mentioned in the search results. Researchers should also consider that experimental systems using limiting amounts of antigen might better reveal CD2's physiological role, as its contribution appears most significant when antigen recognition is suboptimal .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.