Recombinant Rat T-cell surface glycoprotein CD3 delta chain (Cd3d)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Domains

Cd3d is a single-pass type I membrane protein with distinct structural features:

PropertyDetails
Extracellular Domain84 amino acids, immunoglobulin (Ig)-like fold for TCR interaction
Transmembrane Domain21 amino acids, hydrophobic anchor
Cytoplasmic Domain45 amino acids, contains immunoreceptor tyrosine-based activation motifs (ITAMs)
Molecular Weight~19 kDa (calculated); 20–25 kDa (observed via SDS-PAGE due to glycosylation)
Sequence Identity89% with cynomolgus monkey, 61% with rat, 57% with mouse extracellular domains

The recombinant rat Cd3d (residues 22–173) retains these domains and is typically expressed in E. coli with a His-tag or in tag-free formats . Glycosylation patterns in mammalian systems result in higher observed molecular weights (e.g., 27–33 kDa in heterodimers with CD3 epsilon) .

Production and Purification

Recombinant Cd3d is produced using advanced biotechnological methods:

  • Expression Systems: E. coli (common for high yield) , HEK293 cells (for glycosylation studies) .

  • Tags: Polyhistidine (His-tag) or Flag-tag for affinity purification .

  • Purity: >90% as verified by SDS-PAGE and SEC-MALS .

  • Functional Validation: Binding assays confirm interaction with CD3 epsilon (EC₅₀: 2.0–14 μg/mL) .

Research Applications

Recombinant Cd3d is widely used in immunological studies:

Key Applications

MethodDetailsCitations
Western Blot (WB)Detected in Jurkat cells, thymus tissues (1:1000–1:4000 dilution) .
ImmunoprecipitationIdentifies TCR-CD3 interactions (0.5–4.0 μg antibody per 1–3 mg lysate) .
ELISAQuantifies Cd3d in biological samples (MBS1605405 kit) .
Structural StudiesResolves dimerization (45–55 kDa under reducing conditions) .

Pathological and Clinical Relevance

Cd3d dysfunction is linked to severe immunodeficiency:

  • T-/B+/NK+ SCID: Mutations impair TCR-CD3 assembly, causing leukopenia and defective cell-mediated immunity .

  • Therapeutic Targets: Cd3d antibodies (e.g., 16669-1-AP) are used to diagnose T-cell lymphomas and study TCR signaling anomalies .

Evolutionary and Cross-Species Conservation

Cd3d exhibits moderate conservation:

  • Sequence Homology: 57%–89% with mouse, rat, and primate homologs .

  • Functional Redundancy: Cross-reactivity observed in anti-CD3D antibodies for human, mouse, and rat samples .

Associated Signaling Pathways

Cd3d participates in critical immune pathways:

PathwayRole of Cd3d
TCR SignalingITAM phosphorylation recruits ZAP-70 for T-cell activation .
Thymocyte DifferentiationEnsures TCR-CD3 surface expression for T-cell selection .
Primary ImmunodeficiencyDefects disrupt MHC-TCR interactions, impairing immunity .

Future Directions

Ongoing research focuses on:

  • Engineering Cd3d mutants to map ITAM signaling dynamics.

  • Developing Cd3d-targeted therapies for autoimmune diseases and SCID.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time estimates, please consult your local distributors.
Note: All protein orders are shipped with standard blue ice packs. If you require dry ice shipment, please notify us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Cd3d; T3d; T-cell surface glycoprotein CD3 delta chain; T-cell receptor T3 delta chain; CD antigen CD3d
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-173
Protein Length
Full Length of Mature Protein
Species
Rattus norvegicus (Rat)
Target Names
Target Protein Sequence
FKIEVVEYEDKVFVNCNTSIRHLDGSVERWLTKNKSLILGKGILDPRGMYMCNGTEELAKEVSTVQVYYRMCQNCVELDSATLAGVIITDLIATLLLALGVYCFAGHETGRLSGAVDTQVLLKNEQLYQPLRDRDDAQYSRLGGNWPRNKRS
Uniprot No.

Target Background

Function
The CD3 delta chain (CD3d) is an integral component of the TCR-CD3 complex found on the surface of T-lymphocytes. This complex plays a crucial role in adaptive immune responses. When antigen-presenting cells (APCs) activate the T-cell receptor (TCR), the TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G, and CD3Z. All CD3 chains possess immunoreceptor tyrosine-based activation motifs (ITAMs) within their cytoplasmic domains. Upon TCR engagement, these motifs undergo phosphorylation by Src family protein tyrosine kinases LCK and FYN, triggering the activation of downstream signaling pathways. Beyond its role in signal transduction during T-cell activation, CD3D is essential for thymocyte differentiation. It participates in the proper assembly and surface expression of the intracellular TCR-CD3 complex. In the absence of a functional TCR-CD3 complex, thymocytes cannot differentiate correctly. CD3D interacts with CD4 and CD8, forming a functional link between the TCR and coreceptors CD4 and CD8. This link is vital for the activation and positive selection of CD4 or CD8 T-cells.
Database Links
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells.

Q&A

What is the structure and function of CD3 delta chain in the T-cell receptor complex?

CD3 delta (CD3d) is a single-pass type I membrane protein that forms part of the T-cell receptor (TCR)/CD3 complex. The CD3 complex consists of at least four different invariant chains: CD3 gamma, CD3 delta, CD3 epsilon, and CD3 zeta, which associate with the variable TCR alpha/beta or TCR gamma/delta chains .

The primary functions of CD3d include:

  • Signal transduction during TCR antigen recognition

  • Facilitating proper assembly and surface expression of the TCR-CD3 complex

  • Contributing to thymocyte differentiation and T-cell development

  • Establishing functional links between the TCR and coreceptors CD4 and CD8

The rat CD3d protein contains an 84 amino acid extracellular domain, a 21 amino acid transmembrane domain, and a 45 amino acid cytoplasmic domain that contains one immunoreceptor tyrosine-based activation motif (ITAM) .

How does rat CD3d compare structurally to human and mouse homologs?

Rat CD3d shares significant sequence homology with its counterparts in other species, though with notable differences:

Species ComparisonExtracellular Domain Sequence Identity
Rat vs. Human61%
Rat vs. Mouse57%
Human vs. Cynomolgus monkey89%

This moderate conservation across species suggests potential functional differences that researchers should consider when translating findings between animal models and human applications .

What are the typical expression patterns of CD3d in rat tissues?

CD3d is primarily expressed in lymphoid tissues with a distinct hierarchy of expression levels:

  • Highest expression: Thymus, lymph nodes, spleen

  • Moderate expression: Blood, bone marrow

  • Low expression: Other peripheral tissues

This expression pattern reflects its core role in T-cell development, with the thymus being the primary site of T-cell maturation .

What expression systems are commonly used for producing recombinant rat CD3d protein?

Several expression systems have been documented for recombinant rat CD3d production:

  • Bacterial systems (E. coli): Most commonly used for producing non-glycosylated forms of the extracellular domain. This system offers high yields but lacks post-translational modifications .

  • Mammalian expression systems (HEK-293): Provides proper folding and glycosylation patterns, yielding proteins that more closely resemble native CD3d. This is particularly important for conformational epitopes and interaction studies .

For most structural studies, bacterial expression systems suffice, while functional studies often require mammalian expression systems to ensure proper glycosylation .

What purification strategies yield the highest purity and activity for recombinant rat CD3d?

The most effective purification protocol for recombinant rat CD3d typically involves:

  • Immobilized metal affinity chromatography (IMAC): Using histidine-tagged constructs for initial capture

  • Size exclusion chromatography: For removing aggregates and achieving >95% purity

  • Mild elution conditions: Critical for maintaining protein functionality, typically using imidazole gradients rather than pH changes

Researchers report highest activity when purification is performed under non-denaturing conditions, with typical yields of 10-15 mg/L in E. coli systems and 3-5 mg/L in mammalian systems .

How can I verify the proper folding and functionality of purified recombinant rat CD3d?

Multiple complementary approaches should be employed to verify both structural integrity and functional activity:

Structural verification:

  • SDS-PAGE under reducing and non-reducing conditions to check for appropriate molecular weight (approximately 23 kDa for rat CD3d)

  • Circular dichroism spectroscopy to assess secondary structure content

  • Limited proteolysis to evaluate domain organization

Functional verification:

  • Binding assays with recombinant CD3ε to confirm heterodimer formation (typical KD range: 1.0-6.0 μg/mL)

  • Surface plasmon resonance to quantify interaction kinetics with binding partners

  • Cell-based assays examining T-cell activation when exposed to the recombinant protein

The ability to form heterodimers with CD3ε is a critical indicator of functional integrity .

How can recombinant rat CD3d be used for T-cell isolation and enrichment?

Recombinant rat CD3d proteins serve as valuable tools for T-cell isolation through multiple approaches:

  • Magnetic bead-based isolation: When coupled to magnetic beads, recombinant CD3d can be used in positive selection protocols. This typically yields 30-50% recovery of initial CD3+ cells with 90-94% purity .

  • Column-based enrichment: T-cell enrichment columns containing glass beads coated with anti-CD3 antibodies (which can be developed using recombinant CD3d as an immunogen) allow efficient separation of T cells from mixed cell populations .

  • Flow cytometry-based sorting: Fluorescently labeled anti-CD3 antibodies raised against recombinant CD3d enable high-purity isolation of specific T-cell subsets .

The choice of method depends on the required purity, cell viability needs, and downstream applications .

What are the best strategies for using recombinant rat CD3d in antibody development?

When using recombinant rat CD3d for antibody production, consider these empirically validated approaches:

  • Immunization protocol optimization:

    • Most successful protocols use 50-100 μg of recombinant protein per immunization

    • Prime with complete Freund's adjuvant followed by 2-3 boosts with incomplete Freund's adjuvant

    • 3-4 week intervals between immunizations show optimal response

  • Epitope selection considerations:

    • Target the extracellular domain (Phe22-Gly106) for antibodies intended for flow cytometry or cell stimulation

    • Target unique regions that differ from human and mouse homologs to ensure species specificity

  • Validation requirements:

    • Cross-reactivity testing against human and mouse CD3d to confirm specificity

    • Functional testing using T-cell activation assays to confirm biological relevance

Antibodies developed against the extracellular domain typically show higher utility for experimental and diagnostic applications .

How can recombinant rat CD3d be used to study T-cell activation mechanisms?

Recombinant rat CD3d enables several experimental approaches to investigate T-cell activation:

  • Immobilized protein stimulation: When coated on plates or beads, recombinant CD3d (often paired with CD3ε) can trigger TCR signaling. This allows for controlled study of activation parameters without the variability of antigen-presenting cells .

  • Bispecific antibody development: Recombinant CD3d can be used to create bispecific antibodies (e.g., anti-CD3d × anti-tumor antigen) for studying targeted T-cell activation against cancer cells. Two-chain diabody formats show superior specificity compared to tandem single-chain formats .

  • ITAM phosphorylation analysis: By generating phospho-specific antibodies against the CD3d ITAM domain, researchers can track the earliest events in T-cell signaling cascades following stimulation .

  • Structure-function studies: Site-directed mutagenesis of recombinant CD3d permits detailed analysis of which residues are critical for interaction with TCR chains and downstream signaling events .

These approaches have revealed that CD3d contributes significantly to the "differential signaling" model, where various ITAM domains have distinct roles in controlling T-cell activation thresholds .

How does recombinant rat CD3d interact with other components of the TCR complex in reconstitution experiments?

In TCR complex reconstitution studies, recombinant rat CD3d exhibits the following interaction properties:

  • Assembly hierarchy: CD3d preferentially pairs with CD3ε before integrating into the larger TCR complex. The CD3δ-ε heterodimer then associates with TCRα, while CD3γ-ε associates with TCRβ .

  • Stoichiometry considerations: Each functional TCR complex contains one CD3δ-ε heterodimer, contributing two ITAMs to the total of ten ITAMs in the complex. This specific stoichiometry is critical for proper signal transduction .

  • Transmembrane domain interactions: The negatively charged amino acid residues in the transmembrane domain of CD3d form ionic interactions with positively charged residues in the TCR chains. These interactions are essential for complex assembly and stability .

  • Functional reconstitution requirements: Complete expression of the native conformation of the CD3/TCR complex in reconstitution systems requires all four CD3 subunits plus the TCR chains. Absence of any component significantly reduces surface expression .

These reconstitution experiments have demonstrated that CD3d plays a non-redundant role in TCR complex assembly and cannot be fully compensated by the homologous CD3γ chain despite their structural similarities .

What are the challenges in producing biologically active heterodimeric complexes containing recombinant rat CD3d?

Researchers face several technical challenges when attempting to produce functional CD3d-containing heterodimeric complexes:

  • Aggregation propensity: Recombinant CD3d has a tendency to form aggregates, particularly when expressed as tandem single-chain constructs. These aggregates can cause non-specific T-cell activation, confounding experimental results. Two-chain diabody formats show reduced aggregation .

  • Proper heterodimer formation: The assembly of CD3d with CD3ε requires precise expression ratios and folding conditions. Co-expression systems typically yield only 30-40% correctly paired heterodimers .

  • Glycosylation requirements: Native CD3d contains N-linked glycosylation that affects both folding and functionality. E. coli-produced protein lacks these modifications, potentially affecting certain interaction studies .

  • Stability considerations: CD3d-containing heterodimers show reduced stability compared to homodimers, with typical half-lives of 48-72 hours at 4°C. Addition of stabilizing agents such as trehalose (10%) significantly improves stability .

Addressing these challenges requires careful optimization of expression systems, purification protocols, and storage conditions to maintain biological activity .

How can recombinant rat CD3d contribute to the development of immunotherapeutics targeting the TCR/CD3 complex?

Recombinant rat CD3d plays several key roles in developing novel immunotherapeutics:

  • Bispecific T-cell engagers (BiTEs): Recombinant CD3d serves as a valuable target for developing BiTEs that redirect T cells to tumor sites. Research has shown that targeting specific epitopes on CD3d can fine-tune T-cell activation profiles, allowing for more controlled therapeutic responses .

  • CAR T-cell optimization: Understanding CD3d signaling using recombinant proteins helps optimize chimeric antigen receptor (CAR) design, particularly in the configuration of the intracellular signaling domains that often incorporate CD3d ITAM motifs .

  • Species-specific therapeutic testing: The 61% sequence identity between rat and human CD3d extracellular domains necessitates careful epitope selection when using rat models to evaluate CD3-targeting therapeutics intended for human use .

  • Differential ITAM engagement strategies: Studies with recombinant CD3d have revealed that selective engagement of specific ITAMs can produce varied T-cell responses. This principle allows for the design of therapeutics with customized effector profiles (cytotoxic vs. cytokine-producing) .

A key advantage of rat models in CD3-targeted immunotherapy development is that studies can be conducted in immunocompetent animals, allowing evaluation of both on-target effects and immune regulation mechanisms .

What insights does CD3d knockout/mutation research provide about the role of this protein in the TCR complex?

Studies using genetic modification of CD3d have revealed critical species-specific differences in its role:

SpeciesEffect of CD3d Knockout/MutationImplications
HumanSevere combined immunodeficiency with complete absence of mature T cell subpopulations (T-/B+/NK+ SCID)Absolute requirement for T-cell development
MousePartial T-cell development, with mature CD4 and CD8 T cells appearing in the periphery, though in reduced numbersSome functional redundancy with other CD3 chains
RatSimilar to mouse, but with more pronounced defects in TCRαβ lineage developmentIntermediate dependency between human and mouse

These species differences suggest that while CD3d plays a universal role in TCR complex formation, the degree of functional redundancy with other CD3 chains varies significantly between species. This has important implications for translational research and therapeutic development .

Additionally, structure-function studies using point mutations in recombinant CD3d have identified critical residues in:

  • The extracellular domain that mediate CD3ε binding

  • The transmembrane domain that anchor the protein in the TCR complex

  • The ITAM motif that determine signaling specificity

These findings provide valuable targets for rational design of immunomodulatory therapeutics .

How can aggregation issues with recombinant rat CD3d be minimized in experimental settings?

Aggregation of recombinant CD3d can significantly impact experimental outcomes. Research has identified several effective strategies to minimize this issue:

  • Buffer optimization:

    • Including 0.01% Sarcosyl and 1 mM DTT in storage buffers reduces aggregation by 60-70%

    • Maintaining pH between 7.2-7.4 minimizes charge-based aggregation

    • Adding 5% trehalose protects against freeze-thaw induced aggregation

  • Structural modifications:

    • Two-chain diabody formats show significantly less aggregation than tandem single-chain formats

    • Fc fusion proteins demonstrate improved solubility profiles compared to untagged proteins

  • Handling protocols:

    • Avoid vortexing reconstituted protein

    • Maintain stock concentrations between 0.1-1.0 mg/ml

    • Use gentle filtration rather than centrifugation for clarification

  • Storage considerations:

    • Store at -80°C for long-term stability

    • Limit freeze-thaw cycles to a maximum of three

    • Aliquot into single-use volumes to avoid repeated freeze-thaw cycles

Implementation of these strategies has been shown to reduce aggregate formation from >40% to <10% in typical research applications .

What controls are essential when using recombinant rat CD3d in T-cell activation studies?

To ensure valid interpretation of T-cell activation experiments using recombinant CD3d, the following controls are critical:

  • Protein quality controls:

    • Size exclusion chromatography analysis to confirm monomer/dimer state

    • Endotoxin testing (<0.1 EU/μg protein) to prevent non-specific activation

    • Activity verification through CD3ε binding assays

  • Experimental controls:

    • CD3d protein alone (no target cells) to assess baseline stimulation

    • Isotype-matched non-targeting proteins to control for non-specific effects

    • Comparison between CEA+ and CEA- target cells when using bispecific antibodies

  • Cell readout controls:

    • Multiple activation markers beyond CD69 (e.g., IL-2 production, proliferation)

    • Time-course measurements to distinguish between early and sustained activation

    • Dose-response curves to establish optimal working concentrations

These comprehensive controls help distinguish specific CD3d-mediated activation from experimental artifacts and have prevented misinterpretation in published literature .

What are the critical factors affecting binding specificity in CD3d-based immunoassays?

When developing or troubleshooting CD3d-based immunoassays, researchers should consider these empirically determined factors affecting specificity:

  • Epitope accessibility factors:

    • Native versus denatured conformations dramatically affect antibody recognition

    • TCR complex assembly state alters epitope exposure (certain epitopes are masked in the complete complex)

    • Species-specific glycosylation patterns can interfere with antibody binding

  • Cross-reactivity considerations:

    • Antibodies targeting the most conserved regions of CD3d often show cross-reactivity with CD3γ

    • Highest specificity achieved by targeting regions with <40% sequence identity to other CD3 chains

    • Validation against knockout/knockdown samples essential for confirming specificity

  • Assay format influences:

    • Direct coating of recombinant CD3d to plates can denature critical epitopes

    • Capture sandwich formats better preserve native conformation

    • Solution-phase competition assays often provide higher specificity than direct binding assays

These factors explain the variability in reported binding specificities across different immunoassay platforms and highlight the importance of rigorous validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.