Recombinant Rat Taste receptor type 2 member 106 (Tas2r106)

Shipped with Ice Packs
In Stock

Description

Introduction to Tas2r106

Tas2r106 belongs to the Tas2r family of G protein-coupled receptors (GPCRs) that mediate bitter taste perception in mammals. In rats, this receptor is encoded by the Tas2r106 gene (Gene ID: 100310878) . As a member of the bitter taste receptor family, Tas2r106 functions primarily in the detection of potentially harmful substances in food, triggering aversive responses as part of a protective mechanism against the ingestion of toxins.

Bitter taste receptors (Tas2rs) have evolved to detect an extraordinary diversity of bitter compounds found in foods and environmental toxins, translating that detection into gustatory perception via G protein-coupled signaling . While humans possess 25 TAS2R genes, rodent species typically have more, with mice expressing 35 functional Tas2r genes . This diversity highlights the importance of bitter taste perception in mammalian survival and dietary selection.

Genetic and Protein Information

Rat Tas2r106 is characterized by the following molecular identifiers:

ParameterIdentification
Gene NameTas2r106 taste receptor, type 2, member 106
Official SymbolTAS2R106
Gene ID100310878
mRNA RefseqNM_001166680.1
Protein RefseqNP_001160152.1
UniProt IDQ67ET1

The rat Tas2r106 protein consists of 307 amino acids and is primarily localized to the plasma membrane . Like other bitter taste receptors, it likely contains seven transmembrane domains characteristic of class A GPCRs.

Tissue Distribution

Tas2r106 expression has been primarily documented in taste cells of the oral cavity, particularly in the posterior papillae of the tongue. Studies examining the distribution of Tas2r genes in rodents have shown that these receptors are expressed in taste buds of the vallate papillae, where they co-express with signaling components such as α-gustducin .

Interestingly, research has revealed that bitter taste receptors, including members of the Tas2r family, are not limited to gustatory tissues but are also expressed throughout the gastrointestinal tract. Expression profiling of Tas2r genes has demonstrated complex patterns along the alimentary canal, with varying receptor subsets and expression levels in different regions . While the search results do not provide specific information about Tas2r106 expression in extra-oral tissues, studies with other Tas2r receptors suggest potential expression in cells of the respiratory and gastrointestinal tracts .

Comparative Expression Between Species

Comparative studies between rat and mouse taste receptors have shown interesting differences in Tas2r expression patterns. In one study examining taste receptor expression in the soft palate, researchers found that the percentage of Tas2rs co-expressing with Gα-gustducin (Tas2rs/gust) was approximately 65% in rats, which was notably higher than the 46% observed in mice . This suggests species-specific differences in the distribution and potentially the function of these receptors.

Signaling Mechanisms

Tas2r106, like other bitter taste receptors, is coupled to G proteins, particularly Gα-gustducin, which plays a crucial role in taste transduction pathways . Upon activation by bitter compounds, these receptors initiate intracellular signaling cascades that ultimately lead to neurotransmitter release and signal transmission to gustatory afferent nerves.

Species-Specific Functional Differences

Interesting functional differences have been observed between rat and mouse bitter taste perception. Neural response studies comparing rat and mouse responses to bitter (quinine hydrochloride, QHCl) and sweet (sucrose, Suc) stimuli revealed species-specific variations in sensitivity and response magnitude .

For instance, the sum of response magnitudes (SRM) to sucrose in the rat greater superficial petrosal nerve (GSP) was 1.5 times larger than that to quinine, despite having a lower percentage of Tas1r2 (sweet receptor) expressing cells compared to Tas2r (bitter receptor) expressing cells. Conversely, mice showed 2.4-4.7 times larger responses to quinine than to sucrose . These findings suggest that the robustness of taste responses may depend more on receptor density within taste cells rather than the absolute number of receptor-expressing cells.

Moreover, the threshold concentration for detecting sucrose was lower in rats (10^-3 M) than in mice (10^-2 M), while the threshold for quinine was lower in mice (10^-6 M) than in rats (10^-5 M) . These species-specific differences highlight the complex relationship between receptor expression and functional sensitivity.

Recombinant Production Systems

Recombinant rat Tas2r106 protein is produced in heterologous expression systems, with HEK293 cells being a common choice for the expression of GPCRs . This approach allows for the large-scale production of the receptor for various research and biotechnological applications.

Applications of Recombinant Tas2r106

Recombinant Tas2r106 proteins, particularly those coupled to magnetic beads, have numerous applications in research and biotechnology :

  1. Immunoassays: Recombinant receptors can be used in various immunological assays to study receptor-ligand interactions and antibody binding.

  2. In vitro diagnostics: The proteins may serve as tools in diagnostic applications, potentially for detecting specific bitter compounds.

  3. Cell sorting: Magnetic bead-coupled receptors can facilitate the isolation and purification of specific cell populations.

  4. Immunoprecipitation/Co-precipitation: These techniques allow for the study of protein-protein interactions involving Tas2r106.

  5. Protein/antibody separation and purification: The magnetic properties of the beads enable efficient separation of target molecules.

  6. High-throughput operations: Pre-coupled magnetic beads can be integrated with automation equipment for large-scale applications.

Expanding Functions Beyond Taste

Recent research has begun to uncover roles for bitter taste receptors beyond traditional taste perception. Studies in mice have identified Tas2r expression in various extragustatory tissues, including the gastrointestinal tract, where they may serve protective functions against ingested toxins .

For instance, some Tas2r receptors have been found in specialized cells throughout the intestine, such as in mucin-producing goblet cells in the colon and in deep-crypt Paneth cells in the ileum . These discoveries strengthen the hypothesis that bitter taste receptors play defensive roles in the gut, potentially triggering protective responses upon detection of bitter toxins.

Moreover, some research suggests that gastrointestinal Tas2rs might influence glucose metabolism. Studies have shown that enteroendocrine cell lines of gastrointestinal origin express bitter taste receptor mRNA, and stimulation with bitter compounds can elicit calcium elevation and release of gastrointestinal hormones such as CCK and GLP-1 . While these findings are not specific to Tas2r106, they suggest potential broader physiological roles for the Tas2r family.

Comparative Genomics and Evolution

Comparative studies between species have revealed interesting evolutionary patterns in Tas2r receptors. Research indicates that narrowly tuned Tas2r receptors (specialists) are found primarily in species with larger Tas2r gene numbers, such as frogs and zebra finches . This evolutionary diversification likely reflects adaptations to specific ecological niches and dietary patterns.

The continued investigation of species-specific differences in receptor tuning and expression patterns will provide valuable insights into the evolution of taste perception and potentially uncover novel functions for these receptors.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will strive to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is established during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r106; Tas2r19; Taste receptor type 2 member 106; T2R106; Taste receptor type 2 member 19; T2R19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r106
Target Protein Sequence
MLTIPEGILLCFITSGSVLGVLGNGFILHVNCTDCVRQKFSTTGFIFTGLAISRICVICI IISDGYLKLFSPHMVASDAHIIGISYLWIITNHTSTCFATILNLFYFLKIANFSHYIFFC LKRKLNTIFIFLLGCLFISWSVAFPQTVKIFNDKMKHRNTSWKFHLHKSKFIINHILLNL GVIFFCMVAIITSFLLIISLWKHNRKMQLYVSRFKSLNTEVHLKVMKVLISFIILLILHV IGILIETLSFLRYENKLLLILGLNFSSMYPCCHSFILILANNQLKQASLKALKQFKCHKK DKDVRET
Uniprot No.

Target Background

Function
This protein is a putative taste receptor potentially involved in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r106 and how does it function within the rat taste receptor system?

Tas2r106 is a G protein-coupled receptor belonging to the taste receptor type 2 (Tas2r) family, which mediates bitter taste perception in rats. It functions as part of a cluster that includes Tas2r104, Tas2r105, and Tas2r114, with these receptors collectively responding to various bitter compounds. Similar to other bitter taste receptors, Tas2r106 likely signals through the gustducin-mediated pathway involving PLCβ2 activation . While specific rat Tas2r106 ligands are not extensively characterized in the provided literature, comparative studies with mouse models suggest it may respond to bitter compounds such as quinine, denatonium benzoate, and certain plant compounds like cucurbitacins .

How is Tas2r106 expression distributed across gustatory and non-gustatory tissues?

Based on studies of related mouse taste receptors, Tas2r106 is likely primarily expressed in taste buds of the posterior tongue, particularly in the vallate papillae. Expression levels may vary significantly among different taste receptor subtypes, with some receptors showing abundant expression (up to ~20% of α-gustducin mRNA levels) while others demonstrate much lower expression . Importantly, bitter taste receptors are increasingly recognized for their extraoral expression patterns, which may include tissues such as the respiratory system, gastrointestinal tract, and potentially even testis, as demonstrated with other taste receptors . This suggests that Tas2r106 may have physiological functions beyond taste perception, potentially including immune response regulation or other specialized functions in non-gustatory tissues.

What is the genetic organization of the Tas2r106 locus and its relationship to other taste receptors?

Tas2r106 exists as part of a gene cluster that includes Tas2r104, Tas2r105, and Tas2r114, collectively referred to as muroid cluster I . This clustering likely results from evolutionary gene duplication events, suggesting functional relationships among these receptors. The close genomic proximity of these genes has important implications for genetic manipulation studies, as targeted mutations may affect multiple receptors simultaneously. Researchers should note that CRISPR/Cas9 approaches targeting this region might generate overlapping phenotypes due to the clustered arrangement of these genes .

What are the optimal expression systems for producing recombinant Tas2r106 protein?

For functional studies of recombinant Tas2r106, heterologous expression in mammalian cell lines such as HEK293T is recommended. When establishing an expression system, it is critical to co-express appropriate G-protein subunits that facilitate receptor signaling. Based on studies of related bitter taste receptors, Gα16gust44 chimeric proteins provide enhanced sensitivity compared to Gα15-based systems . This difference in signaling efficiency can significantly impact detection of low-efficacy agonists, as demonstrated with mouse Tas2r105, where certain compounds produced responses only in the Gα16gust44 system but not in Gα15-expressing cells .

The following expression system components are recommended:

  • Mammalian expression vector with strong promoter (CMV)

  • HEK293T cells with stable expression of Gα16gust44

  • Addition of signal peptide sequences to improve membrane trafficking

  • Epitope tags (such as FLAG or rho tag) for detection and purification

  • Inducible expression systems for potentially toxic membrane proteins

What methods are most effective for assessing Tas2r106 activation in functional assays?

Calcium imaging represents the gold standard for functional characterization of bitter taste receptors. For reliable assessment of Tas2r106 activation:

  • Establish HEK293T cells stably expressing Gα16gust44 chimeric G-protein

  • Transiently transfect Tas2r106 expression constructs

  • Load cells with calcium-sensitive fluorescent dyes (Fluo-4 AM)

  • Monitor fluorescence changes upon ligand application

  • Normalize responses to positive controls (ATP/ionomycin)

This approach allows for screening of potential agonists across concentration ranges. Based on the methodological insights from mouse receptor studies, it is crucial to select the appropriate G-protein coupling partner, as Gα16gust44-based systems demonstrate superior sensitivity compared to Gα15 systems for detecting low-efficacy agonists . Researchers should be aware that false negatives may occur in less sensitive assay configurations, as demonstrated with mouse Tas2r105, which initially appeared highly selective for cycloheximide but was later shown to respond to multiple bitter compounds in more sensitive assay systems .

How can researchers effectively characterize the ligand profile of Tas2r106?

Comprehensive characterization of Tas2r106 ligand profiles requires systematic screening approaches:

  • Compound library screening: Test diverse bitter compounds including plant alkaloids, synthetic bitter compounds, and potentially toxic substances. Based on studies with mouse bitter taste receptors, libraries of at least 100-150 compounds should be tested to provide adequate coverage of potential ligands .

  • Concentration-response analysis: Determine EC50 values for active compounds to assess receptor sensitivity and compare relative potencies.

  • Structure-activity relationship studies: Compare receptor responses to structurally related compounds to identify molecular determinants of ligand recognition.

  • Comparative analysis with related receptors: Test Tas2r106 alongside other members of the Tas2r104/Tas2r105/Tas2r114 cluster to identify overlapping and distinct ligand specificities.

What in vivo approaches are most informative for studying Tas2r106 function?

In vivo characterization of Tas2r106 function can employ the following approaches:

  • Gene editing technologies: CRISPR/Cas9 can be used to generate Tas2r106 knockout rat models. When targeting the Tas2r106 gene, researchers should consider potential effects on neighboring genes (Tas2r104, Tas2r105, Tas2r114) due to their clustered arrangement .

  • Behavioral assays: Two-bottle preference tests represent a well-established method for assessing changes in taste sensitivity in rodent models. These tests measure preference ratios between test solutions and water, allowing quantification of taste perception. In studies with mice lacking the Tas2r104/Tas2r105/Tas2r114 cluster, significant alterations in responses to bitter compounds including cycloheximide, quinine dihydrochloride, denatonium benzoate, and cucurbitacin B were observed .

  • Gustatory nerve recordings: Electrophysiological recording from the chorda tympani or glossopharyngeal nerves can provide direct measurement of taste nerve responses to bitter stimuli.

  • Calcium imaging in taste cells: Ex vivo calcium imaging of isolated taste cells or taste cell clusters can visualize direct responses to bitter compounds at the cellular level.

The following table summarizes behavioral testing approaches based on mouse Tas2r cluster studies:

Test MethodAdvantagesKey ParametersTypical Findings in Tas2r Mutants
Two-bottle preference testNon-invasive, quantifiableTest duration: 48h; Compound concentrations: 0.01-3mMReduced aversion to specific bitter compounds
Brief-access taste testControls for post-ingestive effectsTrial duration: 5-10s; Multiple presentationsAltered licking responses to bitter stimuli
Taste reactivity testMeasures orofacial responsesVideo recording of facial reactionsReduced rejection behaviors to bitter compounds

What techniques are most effective for quantifying Tas2r106 expression in different tissues?

Accurate quantification of Tas2r106 expression requires sensitive and specific detection methods due to typically low expression levels of taste receptors outside gustatory tissues:

  • Quantitative RT-PCR (qRT-PCR): This represents the gold standard for quantifying Tas2r106 mRNA expression levels. Based on mouse studies, expression levels should be normalized to housekeeping genes and can be compared to α-gustducin expression as a reference point for taste-related genes . In mouse studies, significant variation in expression levels was observed among different taste receptors, with some reaching ~20% of α-gustducin levels while others barely reached detection thresholds .

  • In situ hybridization: This technique allows visualization of Tas2r106 expression at the cellular level within intact tissues. Using digoxigenin-labeled RNA probes specific to Tas2r106 can reveal expression patterns in taste buds and potentially extraoral tissues. Mouse studies demonstrated significant variations in both the number of taste receptor-expressing cells and signal intensity across different Tas2r subtypes .

  • RNAscope technology: This advanced in situ hybridization technique offers improved sensitivity and specificity for detecting low-abundance transcripts and enables multiplexed detection of multiple Tas2r family members simultaneously.

  • Single-cell RNA sequencing: This approach can reveal expression patterns at the single-cell level, identifying specific cell populations expressing Tas2r106 and providing insights into co-expression patterns with other taste receptors and signaling components.

When studying Tas2r expression, researchers should be aware that expression patterns may differ significantly between gustatory and extraoral tissues. For instance, mouse studies showed that Tas2r113 and Tas2r124 exhibited high expression in testis despite having low to moderate expression in taste tissues, while Tas2r114 showed minimal lingual expression but robust testis expression .

What is the physiological significance of Tas2r106 expression in extraoral tissues?

While specific information about rat Tas2r106 extraoral expression is limited in the provided literature, studies of related taste receptors suggest important non-gustatory functions:

  • Immune function: Bitter taste receptors in immune cells may serve as receptors for bacterial compounds, potentially triggering defensive responses. Investigation of Tas2r106 in immune contexts might reveal similar functions.

  • Gastrointestinal roles: Expression in enteroendocrine cells might regulate hormone secretion in response to dietary compounds or microbial metabolites.

  • Reproductive function: The reported expression of some taste receptors in testis suggests potential roles in reproduction . Systematic examination of Tas2r106 in reproductive tissues might reveal unexpected functions.

  • Respiratory system: Bitter taste receptors in respiratory epithelium respond to bacterial compounds and regulate various protective mechanisms.

Methodological approaches for investigating extraoral functions include:

  • Tissue-specific knockout models

  • Ex vivo functional assays with isolated primary cells

  • Immunohistochemistry combined with functional calcium imaging

  • Transcriptomic analysis of tissues from Tas2r106-deficient animals

How do Tas2r106 and related receptors contribute to complex bitter taste perception in vivo?

Understanding the integrative function of Tas2r106 within the broader taste perception system requires specialized approaches:

  • Combinatorial knockout studies: Generate animals lacking multiple Tas2r genes to assess redundancy and cooperative functions. Studies with mice lacking the Tas2r104/Tas2r105/Tas2r114 cluster demonstrated altered responses to multiple bitter compounds including cycloheximide, quinine dihydrochloride, denatonium benzoate, and cucurbitacin B .

  • Gustatory pathway tracing: Use neural tracing techniques to map connections from Tas2r106-expressing cells to higher brain centers.

  • Receptor co-expression analysis: Determine which taste receptors are co-expressed in the same taste cells to understand potential interactions or signal integration.

  • Behavioral discrimination testing: Develop assays to test how loss of Tas2r106 affects discrimination between different bitter compounds rather than just detection thresholds.

Mouse studies revealed that the Tas2r gene cluster containing Tas2r106 homologs contributes significantly to the perception of multiple bitter compounds, with knockout animals showing substantially reduced aversion to specific bitter substances . This suggests that, despite the large number of bitter taste receptors, specific receptors or receptor clusters make non-redundant contributions to bitter taste perception.

What strategies can address low expression or poor membrane trafficking of recombinant Tas2r106?

Researchers often encounter challenges with expression of bitter taste receptors in heterologous systems. The following strategies can improve recombinant Tas2r106 expression:

  • Codon optimization: Adapt the Tas2r106 coding sequence to the codon usage bias of the expression host to enhance translation efficiency.

  • Signal peptide addition: Incorporate N-terminal signal sequences from well-expressed GPCRs (e.g., rhodopsin) to improve membrane targeting.

  • Receptor chimeras: Create chimeric receptors with well-expressed GPCRs, retaining the ligand-binding domains of Tas2r106 while improving trafficking.

  • Chaperone co-expression: Express molecular chaperones that facilitate proper protein folding and membrane insertion.

  • Temperature manipulation: Lower incubation temperature (28-30°C) during expression to allow more time for proper folding.

  • Chemical chaperones: Include compounds like glycerol, DMSO, or 4-phenylbutyrate in the culture medium to stabilize protein folding.

How can researchers distinguish between true negative results and technical limitations when characterizing Tas2r106 ligands?

When characterizing Tas2r106 ligand specificity, it is crucial to discriminate between genuine lack of response and technical limitations:

  • Multiple assay systems: Test receptor activation using different complementary approaches. Mouse studies demonstrated that Tas2r105 appeared highly selective when tested in a Gα15-based system but showed broader responsiveness in a more sensitive Gα16gust44-based system .

  • Positive controls: Include known bitter taste receptor agonists as positive controls to confirm assay functionality.

  • Concentration range: Test compounds across a wide concentration range (typically 0.1-10 mM for bitter compounds) to avoid missing low-potency agonists.

  • G-protein considerations: Test multiple G-protein coupling partners, as bitter taste receptors may couple differentially to various G-proteins, affecting signal detection sensitivity .

  • Cell system validation: Confirm expression and membrane localization of recombinant receptors using immunocytochemistry or fluorescently tagged constructs.

The case of mouse Tas2r105 provides an important cautionary example - initially reported as highly selective for cycloheximide, it was later found to respond to multiple additional compounds when tested in more sensitive assay systems . This highlights the importance of methodological considerations when characterizing taste receptor specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.