Recombinant Rat Taste receptor type 2 member 107 (Tas2r107)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Signaling

Tas2r107 is primarily associated with bitter taste perception but exhibits broader physiological roles:

Bitter Taste Transduction

  • Mechanism: Activates Gα-gustducin, triggering phospholipase Cβ2 (PLCβ2) and TRPM5 channels, leading to calcium influx and afferent signaling .

  • Agonists: Broadly tuned, with partial activation by bitter compounds like chloroquine and cycloheximide (though specificity remains debated) .

Extragustatory Functions

Tissue/OrganFunctionEvidence
Airway Smooth MuscleRelaxation via calcium signaling; implicated in asthma relief
Gastrointestinal TractModulation of gut motility and chemosensation
Urogenital SystemExpression in bladder and urethra; potential role in urinary tract signaling

Immunostaining and RT-PCR data confirm Tas2r107 expression in non-taste cells, including murine airway smooth muscle (ASM) and human detrusor smooth muscle .

Recombinant Protein Variants

VariantHostTagUse CaseSource
Full-length Tas2r107MammalianHisStructural studies, ligand screening
Fc/Avi-tagged Tas2r107HEK293Fc + AviELISA assays, affinity pull-downs
Partial-length Tas2r107E. coliHisAntigen production for antibody tests

ELISA and Detection Kits

  • ELISA Targets: Detects endogenous or recombinant Tas2r107 in lysates or supernatants.

  • Buffer: Tris-based buffer with 50% glycerol for stability .

Phylogenetic Context and Evolution

Tas2r107 clusters with lineage-specific Tas2r genes in rodents, distinct from human orthologs. Key evolutionary insights:

  • Muroid Cluster II: Includes Tas2r107, Tas2r105, and Tas2r114, suggesting specialization for rodent-specific bitter compounds .

  • Pseudogenization: Rat Tas2r107 is functional, unlike some human TAS2R pseudogenes .

Therapeutic Potential

Tas2r107 agonists are explored for:

  1. Asthma: Relaxation of ASM to improve airflow .

  2. Gastrointestinal Disorders: Modulation of gut motility .

  3. Bladder Dysfunction: Regulation of detrusor smooth muscle tone .

Technical Challenges

  • Low Expression: Tas2r107 mRNA is rare in some tissues (e.g., testis) .

  • Signaling Complexity: Requires co-receptors (e.g., Gβγ) for full activation .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize development of the specified tag.
Synonyms
Tas2r107; Tas2r10; Tas2r4; Taste receptor type 2 member 107; T2R107; Taste receptor type 2 member 4; T2R4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r107
Target Protein Sequence
MLSAAEGILLCVVTSEAVLGVLGDTFIALANCMEYAKNKKLSKIGFILIGLAISRIGVVW IIILQGYMQVFFPHILTFGNITEYITYIWVFLNHLSVWFATNLNILYFLKIANFSNSVFL WLKSRVRVVFIFLSGCLLTSWLLCFPQFSKMLNNSKMYWGNTSWLQQQKNVFLINQSLTN LGIFFFIIVSLITCFLLIVFLWRHIRQMHSDGSGLRDLNTEAHVKAMRVLISFAVLFILH FVGLSIQVLCFFLPQNNLLFITGLIATCLYPCGHSIILILGNKQLKQASLKALQHLTCCE TKRNLSVT
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Gene References Into Functions
  1. In rats fed a zinc-deficient diet, the gene expression frequency of TAS2R40 and TAS2R107 on the tongue significantly decreased. Following zinc administration, the frequency of TAS2R107 significantly increased. PMID: 23070743
  2. T2R4 is localized in the neuronal cells of the rat brain stem. PMID: 21303656
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the fundamental expression patterns of Tas2r107 in rat taste tissues?

Taste receptor type 2 (T2R/Tas2r) genes are primarily expressed in gustatory tissue, confirming their role in bitter taste perception. Based on research with other Tas2r receptors, rat Tas2r107 would likely be expressed in subsets of taste receptor cells (TRCs) within taste buds. Expression analysis through quantitative RT-PCR (qRT-PCR) and in situ hybridization can confirm expression levels in different gustatory papillae .

Unlike T1R receptors which show consistent expression patterns across species (mice, rats, humans, pigs, and cats), Tas2r expression exhibits heterogeneity among TRC populations . This suggests that expression analysis of rat Tas2r107 would require careful examination across different papillae locations (fungiform, foliate, circumvallate, and palate).

How does the structure of rat Tas2r107 relate to its function?

Rat Tas2r107, like other bitter taste receptors, belongs to the G protein-coupled receptor (GPCR) superfamily. The functional importance of specific domains can be determined through structural analysis focusing on:

  • N-terminal extracellular domain - often involved in ligand binding

  • Transmembrane domains - critical for signal transduction

  • Intracellular domains - essential for G-protein coupling

For example, research on other Tas2r receptors has demonstrated that mutations in specific amino acid positions can significantly alter receptor sensitivity and specificity. A study with T1R3 showed that substituting isoleucine at position 60 with threonine altered sweetener binding capabilities . Similar structure-function relationships likely exist for rat Tas2r107.

What evidence is required to definitively classify a molecule as a taste receptor?

To properly classify rat Tas2r107 as a functional taste receptor, researchers should fulfill four critical criteria:

  • Establish the molecular identity of the candidate receptor

  • Confirm its expression in taste receptor cells (TRCs)

  • Identify appropriate ligands that activate the receptor

  • Demonstrate changes in taste function resulting from modifications to the receptor

Additional supporting evidence would include demonstrating that:

  • The receptor is expressed in taste receptor cells

  • Cell cultures with heterologously expressed receptors respond to taste stimuli

  • Targeted mutations of the gene affect taste responses

What heterologous expression systems are optimal for functional characterization of rat Tas2r107?

For functional characterization of rat Tas2r107, HEK293T cells expressing chimeric G-proteins represent the gold standard system. Specifically:

  • HEK293T cells expressing Gα16gust44 have demonstrated superior sensitivity compared to cells expressing only Gα15 . This is particularly important for detecting responses to low-efficacy activators that might be missed in less sensitive systems.

  • Immunocytochemistry should be performed to verify proper cell surface localization of the receptor before functional testing. This involves:

    • Adding an N-terminal epitope tag (such as Rho) to the receptor

    • Staining both permeabilized and unpermeabilized cells to distinguish between surface and internal expression

A comparison table of expression systems based on research with other Tas2r receptors:

Expression SystemAdvantagesLimitationsRecommended Use
HEK293T + Gα16gust44Highest sensitivity, detects low-efficacy activatorsMore complex systemPrimary deorphanization screening
HEK293T + Gα15Simpler systemMay miss low-efficacy activatorsConfirmation of strong activators
HEK293T without chimeric G-proteinsMinimal systemLimited signal transductionNot recommended

What methodological approaches should be used to deorphanize rat Tas2r107?

Deorphanization (identifying compounds that activate the receptor) of rat Tas2r107 would require a systematic approach similar to that used for mouse Tas2r receptors:

  • Construct expression vectors containing the full rat Tas2r107 coding sequence with an N-terminal epitope tag

  • Verify surface expression through immunocytochemistry before and after cell permeabilization

  • Screen against a diverse library of bitter compounds (ideally 100+ compounds) at multiple concentrations

  • Perform calcium imaging analysis to detect receptor activation

  • Generate concentration-response curves for positive hits to determine:

    • Threshold concentrations

    • EC50 values (concentration producing half-maximal response)

    • Efficacy (maximum response amplitude)

The comprehensive approach used for mouse Tas2r characterization revealed that receptors vary significantly in their tuning breadth, with some responding to many compounds ("generalists") and others being highly selective ("specialists") .

How can calcium imaging be optimized for studying rat Tas2r107 activation?

Calcium imaging represents the preferred method for measuring Tas2r activation. For rat Tas2r107:

  • Transfection protocol:

    • Co-transfect HEK293T cells with three plasmids: rat Tas2r107, chimeric G-protein (Gα16gust44), and a fluorescent marker to identify transfected cells

    • Optimal plating density: 70,000-100,000 cells per well in 96-well plates

  • Imaging conditions:

    • Load cells with a calcium-sensitive dye (e.g., Fluo-4 AM)

    • Use automated fluorescence plate readers or fluorescence microscopy

    • Record baseline fluorescence for 15-20 seconds before compound application

    • Continue recording for 2-3 minutes after stimulation

  • Data analysis:

    • Calculate relative fluorescence changes (ΔF/F)

    • Generate concentration-response curves

    • Determine threshold concentrations and EC50 values

    • Compare efficacy across different agonists

How can researchers distinguish between non-responsive receptors and experimental limitations?

When working with rat Tas2r107, a lack of observed responses could result from multiple factors rather than indicating a non-functional receptor. Based on research with mouse Tas2rs, investigate the following:

  • Cell surface expression: Perform immunocytochemistry on both permeabilized and unpermeabilized cells to verify receptor trafficking to the plasma membrane. Some receptors (like mouse Tas2r102 and Tas2r131) showed staining only after permeabilization, indicating impaired trafficking .

  • G-protein coupling efficiency: Test alternative G-protein chimeras beyond Gα16gust44, as some Tas2r receptors may couple more efficiently to different G-proteins.

  • Compound library limitations: Initial screening may miss activating compounds. For mouse Tas2rs, researchers tested an additional 77 compounds when initial screenings were unsuccessful .

  • Sequence variations: Confirm the receptor sequence, as single nucleotide polymorphisms in the coding region can potentially affect ligand response profiles. A study comparing C57BL/6 and DBA/2J mouse strains found amino acid sequence differences in 22 of 24 Tas2r genes .

What approaches can determine the tuning breadth of rat Tas2r107?

Determining whether rat Tas2r107 functions as a "specialist" or "generalist" receptor requires comprehensive screening. Based on mouse Tas2r research:

  • Systematic screening: Test against a diverse chemical library (100+ compounds) representing different bitter compound classes.

  • Classification criteria:

    • Generalist receptors: Respond to >30% of test compounds (like mouse Tas2r105)

    • Moderately tuned receptors: Respond to 3-10% of compounds

    • Specialist receptors: Respond to <3% of compounds

  • Quantitative parameters to measure:

    • Number of activating compounds

    • Efficacy (maximum signal amplitude)

    • Potency (threshold concentrations and EC50 values)

    • Concentration ranges spanning activation thresholds

The mouse Tas2r repertoire showed varying tuning properties with one exceptionally broadly tuned receptor (Tas2r105) and many specialist receptors, suggesting mice have a higher proportion of specialist receptors compared to humans .

How does the rat Tas2r107 compare to orthologous receptors in other species?

Comparative analysis between rat Tas2r107 and orthologous receptors in other species can reveal important evolutionary and functional insights:

  • Sequence conservation: Orthologous receptors often show different degrees of sequence conservation in different domains. Critical binding residues may be more conserved than other regions.

  • Functional divergence: Even closely related orthologs can show surprising functional differences. For example, mouse Tas2r138 does not respond to PROP (propylthiouracil), while its human ortholog TAS2R38 is highly sensitive to this compound with an EC50 of 2.1 μM .

  • Species-specific adaptations: Species-specific expansion of Tas2r gene families may have resulted in specialized receptors for bitter compounds of ecological relevance to that species .

A comparative study would require cloning and functional characterization of the orthologous receptors under identical experimental conditions.

How does expression in taste tissues compare to extra-gustatory expression?

When studying rat Tas2r107, researchers should consider that bitter taste receptors are increasingly recognized to have functions beyond taste perception:

  • Tissue-specific expression patterns: Quantitative expression analysis has revealed that rodent Tas2r receptors are expressed in non-gustatory tissues such as testis and heart .

  • Differential regulation: The regulatory mechanisms controlling Tas2r expression likely differ between gustatory and non-gustatory tissues. For example, mouse Tas2r113 and Tas2r124 showed high expression in testis but only moderate expression in gustatory tissue .

  • Functional implications: Extra-gustatory expression suggests additional physiological roles beyond taste perception, requiring tissue-specific functional characterization.

This increasing recognition of extra-gustatory expression highlights the importance of comprehensive expression analysis across multiple tissues when characterizing rat Tas2r107.

What controls are essential when validating recombinant rat Tas2r107 expression?

Proper validation of recombinant rat Tas2r107 expression requires multiple control measures:

  • Positive controls:

    • Include a well-characterized Tas2r with known agonists (such as mouse Tas2r105 with cycloheximide) to validate the expression system and assay conditions

    • Use antibodies against epitope tags to confirm protein expression

  • Negative controls:

    • Mock transfections (transfection reagent without plasmid DNA)

    • Cells expressing only the G-protein without the receptor

    • Non-specific bitter compounds that activate endogenous receptors in the host cells

  • Surface expression verification:

    • Immunocytochemistry before and after permeabilization

    • Cell-surface biotinylation followed by western blotting

The table below summarizes receptor validation approaches based on mouse Tas2r studies:

Validation MethodPurposeExpected Result for Functional Receptor
Immunocytochemistry (unpermeabilized)Surface expressionPositive staining (+)
Immunocytochemistry (permeabilized)Total expressionPositive staining (+)
Calcium imaging with known agonistsFunctional activationConcentration-dependent response
Mock transfection controlsRule out non-specific responsesNo response (-)

How should dose-response relationships be established for rat Tas2r107?

Establishing robust dose-response relationships for rat Tas2r107 requires careful methodology:

  • Concentration range selection:

    • Test a wide concentration range (typically 6-8 log units)

    • Use 3-fold or 10-fold dilution series

    • Include concentrations from nanomolar to millimolar range

  • Receptor activation quantification:

    • Measure relative fluorescence changes (ΔF/F)

    • Calculate threshold concentrations (lowest concentration producing detectable responses)

    • Determine EC50 values using nonlinear regression

    • Assess maximum efficacy (maximum signal amplitude)

  • Data interpretation:

    • Different agonists can exhibit widely different efficacies and potencies

    • Threshold concentrations may span several orders of magnitude

    • Some compounds may show very low potency (millimolar range) but still be physiologically relevant

Mouse Tas2r studies revealed that even a single receptor can respond to different agonists with potencies spanning ~4 orders of magnitude, highlighting the importance of comprehensive dose-response characterization .

How can structure-function relationships be investigated for rat Tas2r107?

Investigating structure-function relationships for rat Tas2r107 would involve systematic mutagenesis approaches:

  • Key regions to target:

    • N-terminal extracellular domain

    • Extracellular loops

    • Transmembrane domains

    • Intracellular loops involved in G-protein coupling

  • Mutagenesis strategies:

    • Alanine scanning mutagenesis to identify critical residues

    • Conservative and non-conservative substitutions to probe specific amino acid requirements

    • Creation of chimeric receptors with other Tas2r receptors to identify domains responsible for specific ligand recognition

  • Functional analysis:

    • Compare EC50 values between wild-type and mutant receptors

    • Assess changes in efficacy (maximum response)

    • Evaluate alterations in ligand selectivity profiles

Prior research with T1R3 demonstrated that a single amino acid substitution (isoleucine to threonine at position 60) significantly reduced binding of several sweeteners to the extracellular N-terminal domain . Similar approaches could identify critical residues in rat Tas2r107.

What are the challenges in correlating in vitro activation with in vivo bitter taste perception?

Translating findings from heterologous expression systems to in vivo bitter taste perception presents several challenges:

  • Receptor expression differences:

    • Heterologous systems typically overexpress receptors compared to native expression levels

    • Native TRCs may express multiple Tas2r receptors with overlapping specificities

  • Signal transduction variations:

    • Artificial G-protein coupling in heterologous systems may differ from native coupling

    • Downstream signaling cascades may be more complex in native TRCs

  • Behavioral validation approaches:

    • Brief-access taste tests can assess avoidance behavior

    • Two-bottle preference tests measure consumption preferences

    • Gustatory nerve recordings can directly measure taste responses

Research with mouse Tas2r105 demonstrated that while this receptor recognized 45 different bitter compounds in vitro, its dominant role in vivo appeared to be in cycloheximide detection, highlighting the complexity of translating in vitro findings to in vivo relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.