Recombinant Rat Taste receptor type 2 member 110 (Tas2r110)

Shipped with Ice Packs
In Stock

Description

Expression Systems and Purification

Recombinant Tas2r110 is produced in multiple heterologous systems, each offering distinct advantages:

Expression HostTagPurityApplicationsCatalog Number
HEK293 cellsHis/Fc/Avi>90%Ligand binding assaysTAS2R110-5600R
E. coliHis-tagged>85%Structural studiesRFL36072RF
Mammalian cellsPre-coupled beadsFunctional gradeImmunoprecipitationTAS2R110-5600R-B

HEK293-derived variants exhibit superior cell surface localization (>70% in unpermeabilized cells), critical for functional assays .

Biochemical Pathways

Tas2r110 participates in:

  • Taste transduction: Interacts with GNG3 (G-protein subunit) and PLCB2 (phospholipase C beta 2) to initiate signaling cascades .

  • Non-gustatory roles: Detected in cardiac tissue, suggesting nutrient-sensing functions .

PathwayKey Partner Proteins
Bitter signalingGNG3, PLCB2, TAS2R108, TAS2R113
Cellular sensingSCNN1B, GRM4, VAPA

Ligand Specificity

Despite extensive deorphanization efforts, Tas2r110 remains unassigned to specific agonists. Surface expression studies confirm its readiness for ligand screening:

ReceptorSurface Localization (Unpermeabilized)Permeabilized Detection
Tas2r110++
Tas2r102+

Research Applications

  • Immunoassays: Used in ELISA (CSB-CF888339RA) for quantifying receptor expression levels .

  • Cell sorting: Magnetic bead-conjugated variants (10 mg/mL, 2 μm particle size) enable high-throughput screening .

  • Western blotting: Detected at ~37 kDa under reducing conditions .

Challenges and Solutions

  • Low agonist affinity: Structural studies suggest conformational flexibility in extracellular loops may hinder ligand binding .

  • Storage stability: Tris-glycerol buffers maintain functionality for >6 months at −80°C .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tas2r110; Tas2r10; Taste receptor type 2 member 110; T2R110; Taste receptor type 2 member 10; T2R10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r110
Target Protein Sequence
MFLHTIKQRDIFTLIIIFFVEITMGILGNGFIALVNIVDWIKRRRISSVDKILTTLALTR LIYAWSMLIFILLFILGPHLIMRSEILTSMGVIWVVNNHFSIWLATCLGVFYFLKIANFS NSLFLYLKWRVKKVVLMIIVVSLIFLILNIFSLEIYDHFSIDVYEGNMSYSLGDSTHFPR IFLFANSSKVFLITNSSQVFLPINSLFMLIPFTVSLVAFFMLIFSLWKHHKKMEVNAKGP RDASTTAHIKALQTGLSFLLLYAIYLLFIVIGILSHKFMGGKLILIFDHICAIVFPISHS FVLILGNSKLRRSTLSVLRFLRCRSKHIHIMDP
Uniprot No.

Target Background

Function
Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links

KEGG: rno:100310875

UniGene: Rn.134165

Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in 15% taste bud cells in circumvallate and foliate papillae but only in 2% in fungiform papillae.

Q&A

What is the genomic organization of rat Tas2r110 and related taste receptors?

Taste receptor genes like Tas2r110 are often organized in clusters in the genome. Similar to the Tas2r104/Tas2r105/Tas2r114 cluster, which is arranged in a head-to-tail array within a 6-kb DNA fragment, Tas2r110 is likely part of a genomic cluster with related taste receptors . This genomic organization represents a case of one-to-multiple orthology, where a single human gene may be orthologous to multiple mouse or rat genes. When designing genetic studies, researchers should consider this clustered arrangement to avoid unintended effects on neighboring genes when targeting Tas2r110.

How do expression patterns of Tas2r110 compare between lingual and extraoral tissues?

Based on patterns observed with related Tas2rs, researchers should anticipate differential expression of Tas2r110 between tissues. Studies have demonstrated that taste receptors like Tas2r114 show varied expression levels, with the lowest expression in lingual papillae but moderate to high expression in kidney, gut, and testis . When investigating Tas2r110, researchers should employ quantitative PCR (qRT-PCR) across multiple tissue types to establish comprehensive expression profiles. This approach requires careful primer design to ensure specificity, given the sequence similarity among Tas2r family members.

What methods are recommended for generating Tas2r110 mutant rodent models?

CRISPR/Cas9 gene editing represents the preferred approach for generating Tas2r110 mutant models. The methodology involves:

  • Target site analysis using CRISPR Design Tools to identify optimal gRNA sequences

  • Synthesis of sgRNA templates using ligation-free PCR approaches

  • In vitro transcription of Cas9 and sgRNA mRNAs

  • Microinjection into zygote cytoplasm

  • Confirmation of mutations using T7EN1 assays and sequencing

The following table outlines recommended primer considerations for Tas2r110 targeting:

PurposeForward Primer ConsiderationsReverse Primer ConsiderationsExpected Fragment Size (bp)
sgRNA template synthesisInclude T7 promoter sequenceInclude scaffold sequence~100
Mutation screeningTarget flanking regionsTarget flanking regions300-500
Expression analysisSpan exon junctionSpan exon junction80-150

When designing gRNAs, prioritize those with high specificity scores to minimize off-target effects .

What is the recommended protocol for reconstituting recombinant Tas2r110 protein?

While specific protocols for Tas2r110 are not directly available in the search results, related recombinant proteins provide guidance. For optimal reconstitution of lyophilized Tas2r110 protein:

  • Reconstitute at 100 μg/mL in PBS

  • For applications requiring higher stability, add at least 0.1% human or bovine serum albumin as a carrier protein

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

  • Use a manual defrost freezer for storage

This approach parallels protocols used for other recombinant proteins where carrier proteins enhance stability, increase shelf-life, and allow for storage at more dilute concentrations .

How should researchers validate Tas2r110 function in heterologous expression systems?

To assess Tas2r110 responsiveness to bitter compounds:

  • Express Tas2r110 in HEK293T cells using appropriate expression vectors

  • Co-express with coupling G-proteins (typically Gα16-gust44)

  • Perform calcium imaging assays using fluorescent indicators like Fluo-4

  • Test activation using a panel of bitter compounds at concentrations ranging from 1 μM to 1 mM

  • Quantify responses as changes in fluorescence intensity (ΔF/F)

  • Determine EC50 values for responsive compounds

This approach has been successful for characterizing the ligand profiles of other Tas2rs and can be applied to Tas2r110 . Include appropriate positive controls (known bitter taste receptors) and negative controls (empty vector-transfected cells).

What RNA extraction and qRT-PCR protocols are most effective for studying Tas2r110 expression?

For reliable gene expression analysis of Tas2r110:

  • Extract total RNA from tissues using Tri-Reagent following manufacturer's protocol

  • Eliminate genomic DNA contamination with DNase I treatment

  • Synthesize cDNA using 1 μg of isolated RNA

  • Perform qRT-PCR using SYBR Green chemistry with 10 ng cDNA per reaction

  • Use cycling conditions: 95°C for 10 min, followed by 40 cycles of 95°C for 10 s, 60°C for 30 s, and 72°C for 1 s

  • Calculate fold change in expression using the 2^(-ΔΔCT) method with appropriate reference genes

For taste tissue specifically, careful microdissection of taste buds is critical to avoid contamination with surrounding tissues .

How can researchers differentiate between Tas2r110 and other closely related Tas2r family members?

Distinguishing between closely related Tas2r family members requires multiple complementary approaches:

  • Sequence-specific molecular techniques:

    • Design PCR primers targeting unique regions in Tas2r110 mRNA

    • Develop specific antibodies against non-conserved epitopes

    • Use RNA interference with highly specific siRNAs

  • Functional discrimination:

    • Establish ligand profiles through dose-response studies with bitter compounds

    • Perform cross-desensitization experiments to identify receptor-specific responses

    • Analyze downstream signaling pathways with selective inhibitors

  • Genetic approaches:

    • Generate receptor-specific knockout models

    • Create tagged receptor variants for direct visualization

    • Employ single-cell RNA sequencing to resolve expression patterns

The high sequence similarity between Tas2r family members (often >70%) necessitates rigorous specificity controls in all experiments .

What behavioral assays best measure Tas2r110-mediated taste responses in rodents?

Two-bottle preference tests represent the gold standard for assessing taste responses:

  • House mice individually in cages with two 100-mL test bottles

  • Acclimatize mice to the setup with distilled water in both bottles for 48 hours

  • Replace one bottle with test solution containing potential Tas2r110 ligands

  • Switch bottle positions every 24 hours to control for side preference

  • Weigh bottles at the beginning and end of each 48-hour period

  • Calculate preference scores as: (test solution intake/total fluid intake) × 100%

When designing these experiments, use wild-type and Tas2r110 knockout mice in parallel. Test solutions should include concentration series of bitter compounds (0.01-10 mM) to generate full dose-response curves .

How do extraoral Tas2r110 functions differ from its role in taste perception?

Based on patterns observed with other Tas2rs, researchers investigating Tas2r110 should consider multiple physiological roles:

  • In the gastrointestinal tract:

    • Hormone secretion regulation

    • Nutrient absorption modulation

    • Influence on gut motility

  • In the respiratory system:

    • Bronchodilation/constriction responses

    • Ciliary beat frequency regulation

    • Antimicrobial compound detection

  • In the urogenital system:

    • Sperm motility and function

    • Renal filtration processes

To investigate these functions, tissue-specific conditional knockout models are recommended, as they allow separation of taste versus extraoral phenotypes. Researchers should employ organ-specific functional assays, such as Ussing chamber experiments for intestinal tissues or ciliary beat frequency measurements for respiratory epithelium .

How should researchers address inconsistencies in Tas2r110 expression data across studies?

Variability in Tas2r110 expression data may stem from:

  • Technical factors:

    • Different primer efficiencies in qPCR studies

    • Varied antibody specificities in immunodetection

    • Inconsistent tissue isolation methods

  • Biological factors:

    • Age-dependent expression patterns

    • Sex-specific regulation

    • Diet or environmental influences

    • Strain differences in laboratory rodents

To address these challenges, researchers should:

  • Use multiple detection methods (qPCR, in situ hybridization, and immunohistochemistry)

  • Include clear descriptions of animal characteristics (age, sex, strain, diet)

  • Employ robust normalization with multiple reference genes

  • Perform power analyses to ensure adequate sample sizes

  • Report raw data alongside normalized values

This systematic approach helps distinguish biological variation from technical artifacts .

What statistical approaches are most appropriate for analyzing Tas2r110 behavioral and functional data?

For rigorous statistical analysis:

  • For two-bottle preference tests:

    • Two-way ANOVA to compare multiple groups and variables

    • Student's t-test for comparing two independent groups

    • Report both preference ratios and absolute consumption values

  • For calcium imaging experiments:

    • Area under the curve (AUC) measurements for response quantification

    • Nonlinear regression for dose-response relationships

    • Mixed-effects models for repeated-measures designs

  • For gene expression studies:

    • Mann-Whitney U test for non-normally distributed data

    • ANCOVA when accounting for confounding variables

    • Benjamini-Hochberg procedure for multiple testing correction

Statistical significance should be set at p < 0.05, but researchers should report exact p-values whenever possible. Sample sizes should be determined through a priori power analysis based on expected effect sizes .

How might Tas2r110 function in metabolic regulation and disease states?

Emerging evidence suggests taste receptors like Tas2r110 may participate in:

  • Glucose homeostasis:

    • Modulation of incretin hormone release

    • Regulation of hepatic glucose production

    • Influence on insulin secretion

  • Inflammatory responses:

    • Detection of bacterial quorum-sensing molecules

    • Regulation of cytokine production

    • Influence on immune cell recruitment

  • Neurological functions:

    • Potential roles in the central nervous system

    • Interactions with other sensory systems

    • Involvement in behavioral responses beyond taste

To investigate these functions, researchers should employ tissue-specific gene deletion approaches combined with metabolic phenotyping (glucose tolerance tests, insulin tolerance tests) and molecular pathway analysis (phospho-protein arrays, transcriptomics) .

What methodological advances will improve Tas2r110 structural and functional characterization?

Future methodological directions include:

  • Advanced structural biology approaches:

    • Cryo-electron microscopy for Tas2r110 structure determination

    • Molecular dynamics simulations of ligand binding

    • Structure-guided mutagenesis to identify critical binding residues

  • Single-cell technologies:

    • Single-cell RNA sequencing to resolve cellular heterogeneity

    • CRISPR activation/inhibition for functional screening

    • Live-cell imaging with genetically encoded sensors

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis of Tas2r110 signaling pathways

    • Machine learning to predict ligand-receptor interactions

These advanced approaches will help address the current technological limitations in studying G protein-coupled receptors like Tas2r110, particularly challenges related to their low expression levels and difficulties in crystallization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.