Recombinant Rat Taste receptor type 2 member 113 (Tas2r113)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Functional Properties

Tas2r113 is a recombinant protein expressed in multiple host systems, including mammalian cells (e.g., HEK293), E. coli, and rodent cell lines. Key structural features include:

  • Tags: His-tag, Avi-tag, and Fc-tag variants for purification and immobilization .

  • Length: Full-length (1–309 amino acids) or partial constructs, depending on expression systems .

  • Function: Exhibits G-protein-coupled receptor activity and signal transducer activity, facilitating intracellular signaling cascades upon ligand binding .

Key Pathways and Interactions

Tas2r113 participates in the taste transduction pathway, interacting with proteins such as:

Pathway ComponentFunction
TAS2R40Bitter taste receptor
ITPR3Intracellular calcium signaling
PRKACAProtein kinase A activation

Production and Characterization

Recombinant Tas2r113 is commercially available in diverse formats:

Expression and Tissue Distribution

Tas2r113 is expressed in gustatory tissues (e.g., posterior tongue papillae) and non-gustatory organs like the testis and heart. In mice, its expression in gustatory cells is moderate compared to highly expressed receptors such as Tas2r118 .

Key Findings:

  • Gustatory Tissue: Detected in vallate papillae via in situ hybridization, though less abundant than Tas2r105 or Tas2r108 .

  • Non-Gustatory Tissue: Exhibits higher expression in testis, suggesting potential roles beyond taste perception .

Functional Studies and Agonist Profiling

While Tas2r113 has been identified as a functional bitter receptor, its specific agonists remain poorly characterized. Comparative studies highlight:

Research Applications

Tas2r113 is utilized in:

  • Heterologous Expression Assays: Studied in HEK293 cells to map ligand-receptor interactions .

  • Species-Specific Bitter Perception: Comparisons with human orthologs (e.g., TAS2R30) explore evolutionary divergence in bitter taste recognition .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes and we will do our best to fulfill it.
Lead Time
Delivery time may vary based on the purchase method and location. For specific delivery estimates, please contact your local distributor.
Note: All our proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us and we will prioritize its development.
Synonyms
Tas2r113; Tas2r30; Taste receptor type 2 member 113; T2R113; Taste receptor type 2 member 30; T2R30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r113
Target Protein Sequence
MVAVLQSTFAIIFSMEFIVGTLGNGFIILMTCIDWVRRRKISLVDQILTALAITRITLIL LVFIDWWVSVLFPALHETGKILRMYFISWTVINHCNLWLTASLSIIYFLKIASFSSIIFL YLKFRVKNVVFVTLLVSLFFLFINTAIVNVYFDVCFDGVQRNVSQVSRLYNHEQICKFLS FTNPMFAFIPFVTSMATFFLLIFSLWRHLKNMKHNAEGCRDVSTIVHIRALQTIIVSVVL YSTFFLSFFVKVWSSGSPERYLIFLFVWALGNAVLPAHTFVLIWGNCRLRWASLSLMLWL RYRFKNIDV
Uniprot No.

Target Background

Function
This protein is a putative taste receptor that may play a role in the perception of bitterness.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tas2r113 and what is its role in rat taste perception?

Tas2r113 is a member of the taste receptor type 2 (Tas2r) family, which functions as bitter taste receptors in vertebrates. In rats, as in other rodents, these G protein-coupled receptors are primarily expressed in taste receptor cells and mediate bitter taste perception by recognizing bitter compounds and initiating signaling cascades.

Tas2r receptors in rodents, including rats, exhibit variable expression levels in taste tissues. Some Tas2r family members, including Tas2r113, have been observed to have differential expression patterns across tissues. While primarily associated with gustatory function, Tas2r113 has shown notable expression in extra-oral tissues such as testis, suggesting additional physiological roles beyond taste perception .

How does Tas2r113 expression in rats compare to other Tas2r family members?

Quantitative expression analyses of rodent Tas2r genes have revealed variable expression levels across different receptor subtypes. In mouse studies, which provide insight into rat receptor patterns due to evolutionary conservation, some Tas2r receptors show abundant expression in taste tissues while others demonstrate lower expression levels.

Interestingly, Tas2r113 has been observed to have relatively high expression in non-gustatory tissues such as testis, while showing low to moderate expression in gustatory tissue. This contrasts with other Tas2r family members that may show opposite expression patterns, suggesting differential regulation of Tas2r genes across tissues .

How is recombinant Tas2r113 typically produced for research applications?

Recombinant Tas2r113 is typically produced using heterologous expression systems, most commonly in HEK293 cells (human embryonic kidney cells). The process involves:

  • Cloning the rat Tas2r113 gene into an appropriate expression vector

  • Transfecting the construct into HEK293 cells

  • Culturing the cells to express the recombinant protein

  • Harvesting and purifying the protein using affinity tags (commonly His-tags)

  • Confirming expression through Western blotting or functional assays

Similar to other recombinant taste receptors, the protein can be produced with various tags for detection, purification, or coupling to substrates such as magnetic beads, as seen with related Tas2r family members .

What are the challenges in functionally characterizing Tas2r113 compared to other taste receptors?

Functionally characterizing Tas2r113 presents several research challenges:

  • Co-expression requirements: Like other bitter taste receptors, Tas2r113 may require co-expression with signaling components such as Gα-gustducin or chimeric G proteins (e.g., Gα16gust44) in heterologous expression systems to achieve proper coupling and signal transduction.

  • Receptor sensitivity differences: Experimental methodology significantly impacts detection sensitivity. For example, studies with the related Tas2r105 revealed discrepancies in agonist profiles when using different G protein subunits. Cells expressing Gα16gust44 showed higher sensitivity than those expressing Gα15, allowing detection of low-efficacy activators that might be missed in less sensitive systems .

  • Proper trafficking: Ensuring proper membrane localization of the recombinant receptor can be challenging, often requiring optimization of expression constructs.

  • Agonist identification: The broad and sometimes overlapping agonist profiles of Tas2r receptors make it difficult to identify specific ligands for individual receptors like Tas2r113.

Researchers should consider these factors when designing functional characterization experiments for Tas2r113 to avoid false negative results or incomplete agonist profiles.

How does the agonist profile of Tas2r113 compare with its human ortholog, and what are the implications for translational research?

Based on comparative studies of bitter taste receptors across species, there are important considerations when comparing rat Tas2r113 with human orthologs:

  • Sequence-function relationships: Despite high sequence similarity between orthologs, functional studies of bitter taste receptors have revealed that even minor differences in amino acid sequences can substantially alter agonist profiles. Structure-function analyses of human TAS2Rs show that few amino acid differences can account for largely deviating agonist spectra .

  • Evolutionary adaptations: Species-specific bitter taste receptor profiles likely evolved in response to different ecological niches and dietary exposures to bitter compounds.

  • Ortholog identification challenges: True functional orthologs should recognize the same bitter compounds, but this cannot be reliably predicted based solely on sequence identity. Experimental validation is necessary to establish functional orthology.

What methodological approaches can resolve contradictions in Tas2r113 functional data across different studies?

Resolving contradictions in Tas2r113 functional data requires systematic methodological approaches:

  • Standardized expression systems: Adopt consistent heterologous expression systems with standardized G protein coupling partners. The choice between Gα15, Gα16, or chimeric Gα16gust44 significantly impacts detection sensitivity .

  • Dose-response analysis: Complete dose-response relationships should be established rather than single-concentration screenings, which may miss low-efficacy agonists.

  • Multiple readout systems: Employ complementary assays such as calcium imaging, cAMP measurements, and β-arrestin recruitment to comprehensively characterize receptor function.

  • Protein expression verification: Quantify surface expression levels across studies to normalize functional data and account for expression-dependent effects.

  • Inter-laboratory validation: Conduct parallel testing across different laboratories using standardized protocols and compound libraries.

When contradictions are observed, structured analysis approaches that systematically compare experimental conditions can identify the source of discrepancies, similar to contradiction detection methodologies used in other scientific domains .

What expression systems are optimal for functional studies of recombinant Tas2r113?

For optimal functional studies of recombinant Tas2r113, researchers should consider the following expression system parameters:

Cell Line Selection:

  • HEK293T cells are most commonly used due to their high transfection efficiency and robust expression of GPCRs

  • CHO cells provide an alternative with different glycosylation patterns

  • Inducible expression systems may be beneficial for potentially toxic or low-expressing receptors

Expression Vector Components:

  • Strong promoters (CMV) for high expression levels

  • Codon optimization for rat proteins expressed in mammalian cells

  • N-terminal tags: Inclusion of the first 45 amino acids of rat somatostatin receptor 3 may improve membrane targeting

  • C-terminal epitope tags (e.g., FLAG, His) for detection and purification

Co-expression Components:

  • Gα16gust44 chimeric G protein for optimal coupling efficiency

  • Promiscuous G proteins to enhance signal detection sensitivity

  • In cases of poor surface expression, chaperone proteins may improve trafficking

Based on experiments with related Tas2r family members, the Gα16gust44 system demonstrates superior sensitivity for detecting low-efficacy agonists compared to Gα15-based assays, making it the preferred choice for comprehensive agonist profiling .

What techniques are recommended for analyzing Tas2r113 expression patterns in different rat tissues?

A multi-modal approach to analyzing Tas2r113 expression provides the most comprehensive characterization:

Quantitative RT-PCR (qRT-PCR):

  • Design primer pairs specific to Tas2r113, avoiding cross-reactivity with other Tas2r family members

  • Include reference genes (e.g., GAPDH, β-actin) for normalization

  • Compare expression levels to known markers such as α-gustducin to establish relative abundance

In Situ Hybridization:

  • Use digoxigenin-labeled riboprobes specific to Tas2r113

  • Perform parallel staining with sense probes as negative controls

  • Combine with immunohistochemistry for cell-type markers to identify specific expressing populations

RNA-Seq:

  • For unbiased transcriptomic profiling across tissues

  • Provides insight into co-expressed genes and potential regulatory networks

Single-Cell RNA-Seq:

  • To resolve cellular heterogeneity within taste buds

  • Identifies co-expression patterns with other taste receptors and signaling components

This integrated approach has revealed that different Tas2r family members show variable expression patterns. For example, in mice, Tas2r113 showed higher expression in testis while exhibiting low to moderate expression in gustatory tissue , highlighting the importance of multi-tissue analysis for comprehensive characterization.

What are the recommended protocols for deorphanizing Tas2r113 and identifying its agonist profile?

A systematic deorphanization approach for Tas2r113 should include:

Compound Library Preparation:

  • Establish a diverse bitter compound library (100-200 compounds)

  • Include natural bitter compounds, synthetic bitter molecules, and pharmacological agents

  • Test multiple concentrations (typically 3-300 μM) to establish dose-response relationships

Functional Assays:

  • Real-time calcium imaging: Monitor Ca²⁺ flux using fluorescent indicators (Fluo-4 AM)

  • FLIPR-based high-throughput screening for initial compound identification

  • Secondary validation with bioluminescence resonance energy transfer (BRET) assays

Expression System:

  • Transiently transfect HEK293T cells with Tas2r113 and Gα16gust44

  • Include positive controls (known broadly-tuned bitter receptors) and empty vector controls

  • Verify surface expression via immunocytochemistry or flow cytometry

Data Analysis:

  • Calculate EC₅₀ values for active compounds

  • Determine receptor tuning breadth by comparing the number of active compounds

  • Classify the receptor as specialist (narrow tuning) or generalist (broad tuning)

This methodological approach, similar to that used for other bitter taste receptors, has successfully identified agonists for 21 of 35 mouse Tas2r receptors, revealing variation in tuning breadth from specialists to generalists .

How does Tas2r113 fit into the evolutionary history of bitter taste receptors across species?

Tas2r113 exists within a complex evolutionary framework of bitter taste receptors:

Phylogenetic Classification:

  • Tas2r genes in vertebrates evolved through multiple gene duplication and diversification events

  • Rat Tas2r113 belongs to a rodent-specific cluster of bitter taste receptors that expanded after the divergence from primate lineages

  • Some Tas2r genes show clear one-to-one orthology between rodents and primates, while others (including Tas2r113) belong to species-specific expansions

Evolutionary Pressure:

  • Bitter taste receptors evolved primarily as defense mechanisms against potentially toxic compounds

  • Sequence analysis suggests many bitter receptors, including Tas2r113, have undergone positive selection, indicating adaptation to specific ecological niches

  • The gene's expression in non-gustatory tissues suggests potential secondary functions that emerged during evolution

Cross-Species Comparison:

  • While some Tas2r genes located on human chromosomes 5 and 7 and mouse chromosomes 2 and 15 exhibit one-to-one orthology, suggesting they developed prior to rodent-primate divergence , many others show species-specific patterns

  • These evolutionary differences highlight the importance of functional characterization rather than relying solely on sequence homology

Understanding Tas2r113's evolutionary context provides insights into its potential functions and helps predict which compounds might activate this receptor based on ecological relevance to rodents.

What evidence exists for extra-oral functions of Tas2r113, and how might these inform research applications?

Evidence for extra-oral functions of Tas2r113 and related bitter taste receptors includes:

Expression Pattern Analysis:

  • Quantitative expression analyses have revealed Tas2r113 expression in non-gustatory tissues, with particularly high expression observed in rodent testis

  • This contrasts with its low to moderate expression in gustatory tissue, suggesting possible specialized roles in reproductive biology

Potential Physiological Roles:

  • Chemosensing: Detection of endogenous bitter compounds in internal tissues

  • Regulation of hormone secretion

  • Immune modulation

  • Metabolic regulation

  • Sperm function and fertilization

Research Implications:

  • Investigations should explore Tas2r113 signaling pathways in testicular cells

  • Knockout studies may reveal phenotypes unrelated to taste perception

  • Potential applications in reproductive biology and fertility research

  • Possible pharmacological targets for tissues expressing Tas2r113

The differential tissue expression pattern of Tas2r113 suggests that genetic regulation in taste papillae differs from that in other tissues , highlighting the need for tissue-specific research approaches when studying this receptor.

What are common technical challenges in working with recombinant Tas2r113 and how can they be addressed?

Researchers face several technical challenges when working with recombinant Tas2r113:

Expression Challenges:

  • Poor surface expression: Optimize with N-terminal signal sequences and chaperones

  • Protein misfolding: Test expression at lower temperatures (30°C instead of 37°C)

  • Toxic effects on host cells: Use inducible expression systems with tight regulation

Purification Challenges:

  • Low yield: Scale up production or optimize codon usage for expression host

  • Maintaining native conformation: Use mild detergents and avoid harsh elution conditions

  • Aggregation: Include stabilizing agents and optimize buffer conditions

Functional Assay Challenges:

  • Low signal-to-noise ratio: Increase sensitivity by using Gα16gust44 instead of Gα15

  • False negatives: Test broader concentration ranges and use multiple detection methods

  • Ligand solubility issues: Prepare proper stock solutions with appropriate vehicles

Quality Control Recommendations:

  • Verify protein identity by mass spectrometry and N-terminal sequencing

  • Confirm homogeneity by size-exclusion chromatography

  • Test functionality with known agonists of related receptors

Addressing these challenges requires systematic optimization and appropriate controls to ensure reliable and reproducible results when working with this challenging receptor.

How can researchers validate the specificity and functionality of recombinant Tas2r113 preparations?

Comprehensive validation of recombinant Tas2r113 requires multiple complementary approaches:

Biochemical Validation:

  • Western blot analysis using Tas2r113-specific antibodies

  • Size-exclusion chromatography to confirm monodispersity

  • Thermal stability assays to assess protein folding

  • Surface plasmon resonance to measure ligand binding

Functional Validation:

  • Calcium mobilization assays with known bitter compounds

  • Dose-response curves to determine EC₅₀ values

  • G protein coupling assays to confirm signal transduction

  • Comparison of responses to related Tas2r receptors

Specificity Controls:

  • Mutational analysis of key residues predicted to be involved in ligand binding

  • Competitive binding assays with known and novel ligands

  • Cross-reactivity testing with structurally related compounds

  • Negative controls using non-transfected cells or cells expressing empty vectors

Cross-Laboratory Validation:

  • Standardized assay protocols across different laboratories

  • Reference standards for quantitative comparisons

  • Blinded testing of compound libraries

These validation approaches ensure that observed responses are truly mediated by functional Tas2r113 rather than by endogenous receptors or non-specific effects, addressing the challenges of contradictory results often seen in bitter taste receptor research .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.