Recombinant Rat Taste receptor type 2 member 114 (Tas2r114)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rat Tas2r114

Recombinant Rat Tas2r114 is produced by expressing the Tas2r114 gene (Gene ID: 78982) in HEK293 cells, followed by purification using His (Fc)-Avi tags . Key features include:

  • Species: Rattus norvegicus

  • UniProt ID: Q9JKT8

  • mRNA RefSeq: NM_023996.1

  • Protein RefSeq: NP_076486.1

This receptor is stabilized in PBS buffer with ≥85% purity and endotoxin levels <1.0 EU/μg . Its recombinant form enables functional studies of bitter compound interactions and signaling mechanisms.

Gene and Protein Data

PropertyDetails
Chromosomal LocationNot explicitly mapped in rat genome (orthologous to mouse Chr 6)
Protein Length309 amino acids
Domains7-transmembrane GPCR structure
Expression SitesPosterior tongue papillae, kidney, gut, testis

Tas2r114 exhibits low basal expression in lingual taste cells but higher activity in extraoral tissues . It detects cucurbitacins (bitter plant compounds) with higher efficacy than other Tas2rs .

Functional Insights from Knockout Studies

CRISPR/Cas9-generated Tas2r104/105/114 cluster knockout mice revealed:

  • Loss of bitter perception: Eliminated responses to cucurbitacin B (CuB), denatonium benzoate, and quinine .

  • Compensatory mechanisms: Altered expression of other Tas2r genes (e.g., Tas2r108, Tas2r137) in taste buds .

  • Extraoral roles: Moderate-to-high expression in kidney and gut suggests non-gustatory functions .

Key Uses of Recombinant Tas2r114

  • Ligand Screening: Identifies agonists/antagonists via calcium flux assays .

  • Structural Studies: Supports cryo-EM and mutagenesis to map binding pockets (e.g., dual flufenamic acid binding in human TAS2R14 homolog) .

  • Pathway Analysis: Part of the taste transduction pathway involving PLCβ2 and GNAT3 .

Recent Advances and Challenges

  • Dual ligand binding: Structural studies on human TAS2R14 homolog suggest intracellular and transmembrane binding pockets, implying complex activation mechanisms .

  • Expression hurdles: Low surface localization in heterologous systems requires optimized trafficking tags (e.g., Rho epitopes) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tas2r114; Tas2r5; Taste receptor type 2 member 114; T2R114; Taste receptor type 2 member 5; T2R5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r114
Target Protein Sequence
MLGAMEGVLLSVATSEALLGIVGNTFIALVNCMDCTRNKNLYNIGFILTGLAISRICLVW ILITEAYIKIFSPQLLSPINIIELISYLWIITSQLNVWFATSLSIFYFLKIANFSHHIFL WLKRRINIVFAFLIGCLLMSWLFSFPVVVKMVKDKKMLYINSSWQIHMKKSELIINYVFT NGGVFLLFIIMLIVCFLLIISLWRHSKWMQSNESGFRDLNTEVHVKTIKVLLSFIILFIL HLIGITINVICLLVPENNLLFVFGLTIAFLYPCCHSLILILANSRLKRCFVRILQQLMCS EEGKEFRNT
Uniprot No.

Target Background

Function
Putative taste receptor potentially involved in bitterness perception.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the tissue expression profile of Tas2r114 in rats, and how does it compare to other species?

Tas2r114 in rats, similar to its mouse ortholog, shows differential expression patterns across tissues. While having relatively low expression levels in lingual papillae and gustatory tissue, Tas2r114 exhibits more robust expression in extraoral tissues such as testis, kidney, and gut . This expression pattern suggests that Tas2r114 likely serves diverse physiological functions beyond taste perception.

In comparative studies, mouse Tas2r114 demonstrates one of the lowest expression levels among bitter taste receptors in taste buds, making it challenging to detect through conventional methods . When designing experiments to characterize rat Tas2r114 expression, researchers should consider using highly sensitive methods such as quantitative RT-PCR with properly designed primers and validated reference genes, as well as RNAscope in situ hybridization for spatial localization within tissues.

What approaches are most effective for detecting endogenous Tas2r114 expression in rat tissue samples?

For detecting endogenous Tas2r114 in rat tissues, a multi-method approach is recommended:

For extraoral tissues where Tas2r114 shows higher expression (e.g., testis, kidney), detection sensitivity requirements may be less stringent than for taste tissues.

What are the established agonists for rat Tas2r114, and how do they differ from those of mouse and human orthologs?

Based on studies with mouse Tas2r114, several bitter compounds have been identified as potential agonists that may also activate rat Tas2r114:

Compound ClassExamplesEffective Concentration RangeRelative Efficacy
CucurbitacinsCucurbitacin B, D, E, ILow micromolarHigh
AlkaloidsQuinine3-10 μMModerate
Other bittersDenatonium benzoateLow millimolarModerate

When characterizing rat Tas2r114 agonist profiles, researchers should systematically test a diverse panel of bitter compounds, starting with those known to activate mouse Tas2r114, and employ dose-response analyses to determine potency and efficacy parameters.

What heterologous expression systems are most suitable for functional characterization of recombinant rat Tas2r114?

For functional characterization of recombinant rat Tas2r114, several heterologous expression systems have demonstrated effectiveness for bitter taste receptors:

  • HEK293T cells expressing Gα16gust44: This system provides superior sensitivity compared to cells expressing only Gα15, particularly for detecting responses to low-efficacy agonists. The chimeric G protein (Gα16gust44) facilitates coupling between the taste receptor and phospholipase C (PLC) signaling pathway .

  • Calcium imaging assay parameters:

    • Transfection: Co-transfect Tas2r114 with Gα16gust44 (3:1 ratio)

    • Fluorescent indicator: Fura-2/AM (5 μM loading for 30 minutes)

    • Signal detection: Ratiometric measurement (340/380 nm)

    • Analysis: Calculate ΔF/F values and determine EC50 values from dose-response curves

  • Key controls to include:

    • Empty vector transfected cells

    • Cells expressing known functional bitter receptors (e.g., Tas2r105)

    • Multiple biological replicates (minimum n=3)

The choice of expression system significantly impacts detection sensitivity. For Tas2r114, which may respond to agonists with lower efficacy, the Gα16gust44 system is particularly important for reliable detection of responses .

What expression vectors and tags are optimal for recombinant rat Tas2r114 production?

For successful production of functional recombinant rat Tas2r114, consider these expression system components:

  • Vector selection:

    • pCDNA3.1: Widely used for mammalian expression with CMV promoter

    • pEF1α-based vectors: Provide more sustained expression compared to CMV promoter

    • Inducible expression systems: T-REx or Tet-On systems allow controlled expression levels

  • Epitope tags:

    • N-terminal tags: Rhodopsin or FLAG tags improve membrane trafficking

    • C-terminal tags: His6 or 1D4 tags facilitate purification

    • Location considerations: Position tags to avoid disrupting signal peptides or membrane topology

  • SSB-Tas2r114 fusion approach:

    • Creating a fusion protein with the first 45 amino acids of somatostatin receptor type 3 (SSB) increases surface expression

    • This approach has been successful for other bitter taste receptors and may enhance rat Tas2r114 membrane targeting

  • Codon optimization:

    • Optimize codons for the expression host (mammalian cells)

    • Eliminate cryptic splice sites and destabilizing RNA elements

When designing constructs, incorporate flanking restriction sites to facilitate subcloning and consider a fluorescent protein fusion (e.g., GFP) to monitor expression and localization, with appropriate controls to ensure the fusion doesn't impair receptor function.

What are the critical factors for successful solubilization and purification of functional rat Tas2r114?

Purification of functional GPCRs like Tas2r114 requires careful optimization:

  • Membrane preparation:

    • Harvest cells 48-72 hours post-transfection

    • Prepare membranes using nitrogen cavitation or mechanical disruption

    • Include protease inhibitors throughout all steps

  • Detergent screening:

    DetergentConcentrationAdvantagesConsiderations
    DDM1%Widely used for GPCRsMay destabilize Tas2r114
    LMNG0.5-1%Enhanced stabilityHigher cost
    Digitonin0.5%Gentle extractionLower yield
    GDN0.1%Preserves functionRecent development
  • Stabilization approaches:

    • Addition of specific ligands during purification

    • Inclusion of cholesteryl hemisuccinate (CHS)

    • Glycerol (10%) as a stabilizing agent

    • Lipid nanodiscs or SMALPs for a more native-like environment

  • Purification strategy:

    • IMAC purification via His-tag

    • Optional second step: Size exclusion chromatography

    • Quality control: SDS-PAGE, Western blot, and functional assays

The recent structural characterization of human TAS2R14 provides valuable insights that can be applied to rat Tas2r114 purification, particularly regarding detergent selection and stabilization approaches.

How does rat Tas2r114 relate to the evolutionary clustering and genomic organization of bitter taste receptor genes across species?

Tas2r114 belongs to a genomically clustered group of bitter taste receptor genes with interesting evolutionary features:

  • Genomic organization:

    • In mice, Tas2r104, Tas2r105, and Tas2r114 are organized as a head-to-tail array within a single 6-kb DNA fragment

    • This cluster represents a common pattern in bitter taste receptor evolution where gene duplication events have created species-specific expansions

  • Orthology relationships:

    • Rat Tas2r114 is part of a rodent-specific expansion of bitter receptors

    • The cluster represents a case of "one-to-multiple orthology" where a single human gene corresponds to multiple rodent genes

    • This genomic arrangement suggests functional diversification after gene duplication events

  • Evolutionary significance:

    • The expansion of this cluster in rodents likely reflects adaptation to specific ecological niches and dietary patterns

    • Differences in receptor tuning between species correlate with dietary exposures to bitter toxins

    • Rodents generally possess more narrowly tuned bitter receptors compared to humans

When studying rat Tas2r114, researchers should consider its evolutionary context, particularly how its function may have diverged from related receptors following duplication events, as this can provide insights into species-specific adaptations in bitter taste perception.

What are the key structural differences between rat Tas2r114 and its human ortholog that affect ligand binding properties?

Although direct structural information for rat Tas2r114 is not yet available, insights from related receptors provide valuable comparative information:

  • Binding pocket characteristics:

    • The recent cryo-EM structure of human TAS2R14 reveals a dual binding mode for flufenamic acid (FFA), with binding sites in both the transmembrane bundle and the intracellular facet

    • Rat Tas2r114 likely shares similar structural architecture but with species-specific variations in binding pocket residues

  • Critical binding residues:

    DomainHuman TAS2R14 ResiduesPotential Rat Tas2r114 EquivalentsFunctional Significance
    TM3Residues forming canonical pocketMay show substitutionsAltered ligand specificity
    TM6-TM7 interfaceResidues contacting G proteinMore conservedMaintained signaling
    Extracellular loopsVariable regionsHighly divergentSpecies-specific recognition
  • Functional implications:

    • Rodent bitter receptors tend to be more narrowly tuned than human orthologs

    • These differences likely reflect evolutionary adaptation to different dietary exposures

    • Modifications in binding pocket architecture between species affect both the range of compounds recognized and their binding affinities

When conducting structure-function studies of rat Tas2r114, researchers should focus on identifying the specific residues that contribute to species-specific differences in ligand recognition through mutagenesis approaches and comparative homology modeling based on the human TAS2R14 structure .

How can CRISPR/Cas9 gene editing be optimized for studying Tas2r114 function in vivo?

CRISPR/Cas9 gene editing offers powerful approaches for studying Tas2r114 function:

  • Design strategy for Tas2r114-specific targeting:

    • Select target sites unique to Tas2r114 to avoid off-target effects on related Tas2r genes

    • Design multiple sgRNAs targeting different regions of the gene

    • Validate sgRNA efficiency using T7 Endonuclease I assays in cell lines before in vivo use

  • Knock-out vs. knock-in approaches:

    ApproachAdvantagesConsiderationsApplication
    Complete knockoutEliminates all functionMay affect cluster regulationPhenotypic screening
    Point mutationsAlters specific functionsRequires precise editingStructure-function studies
    Reporter knock-inMaintains expression patternComplex designExpression analysis
    Conditional knockoutTissue-specific deletionRequires Cre-loxP systemIsolate tissue-specific roles
  • Verification methods:

    • Genomic PCR and sequencing to confirm mutations

    • qRT-PCR to assess expression changes of Tas2r114 and related genes

    • Immunostaining to verify protein-level changes

    • Functional assays including two-bottle preference tests for behavioral phenotyping

  • Challenges specific to Tas2r114:

    • Genomic clustering may require specialized approaches to avoid affecting neighboring genes

    • Low expression levels in some tissues necessitate sensitive detection methods

    • Functional redundancy with other Tas2rs may mask phenotypes in single-gene knockouts

When targeting the Tas2r104/Tas2r105/Tas2r114 cluster, consider a strategy similar to the one described in search result , where researchers successfully generated mutant mice with altered taste perception to specific bitter compounds.

What extraoral functions of Tas2r114 have been identified, and how can recombinant protein be used to investigate these roles?

Bitter taste receptors including Tas2r114 have emerged as important signaling molecules beyond the oral cavity:

  • Extraoral expression sites and potential functions:

    TissueExpression LevelPotential FunctionsDetection Methods
    TestisRobustSperm function, fertilizationqRT-PCR, immunohistochemistry
    KidneyModerate-highMetabolite sensing, filtrationIn situ hybridization
    GutModerateNutrient sensing, motility regulationFunctional assays
    AirwaysUnknown for ratInnate immunity, bronchodilationTo be investigated
  • Signaling mechanisms in extraoral tissues:

    • May utilize alternative signaling pathways compared to taste cells

    • Often couples to different G proteins in a tissue-specific manner

    • May involve calcium signaling, cAMP production, or alternative second messengers

  • Research approaches using recombinant Tas2r114:

    • Cell-type specific expression profiling using sorted populations

    • Primary cell cultures from extraoral tissues transfected with recombinant Tas2r114

    • Ex vivo tissue preparations with application of identified Tas2r114 agonists

    • Development of tissue-specific transgenic reporter models

  • Physiological significance:

    • Potential roles in metabolite sensing and detoxification

    • Involvement in cellular homeostasis and tissue-specific functions

    • Possible pathophysiological relevance in disease states

Given the differential expression of Tas2r114 across tissues, researchers should investigate tissue-specific signaling partners and downstream pathways that may differ from those in taste cells when studying extraoral functions.

What approaches can resolve contradictory findings between in vitro and in vivo studies of Tas2r114 function?

Researchers frequently encounter discrepancies between in vitro characterization and in vivo function of taste receptors. Several methodological approaches can help resolve these contradictions:

  • Sources of discrepancy:

    • Expression system artifacts in heterologous cells

    • Differences in G protein coupling efficiency

    • Absence of accessory proteins and modulators

    • Compensatory mechanisms in knockout models

  • Reconciliation strategies:

    ChallengeMethodological SolutionValidation Approach
    Sensitivity differencesUse Gα16gust44 in heterologous assaysCompare EC50 values between systems
    Functional redundancyCombinatorial receptor knockoutsSystematic behavioral testing
    Expression level variationTitrated expression systemsCorrelation with endogenous levels
    Signaling discrepanciesPrimary cell culture modelsConfirm pathway components
  • Comparative approaches:

    • Test compounds identified in vitro using behavioral assays

    • Perform ex vivo tissue preparations with calcium imaging

    • Develop knock-in models expressing modified receptors

    • Use pharmacological inhibitors to validate in vivo pathways

  • Integrated data analysis:

    • Correlate potency/efficacy data from in vitro assays with behavioral thresholds

    • Account for pharmacokinetic/bioavailability factors in in vivo studies

    • Consider circuit-level effects for behavioral readouts

The case of Tas2r105 in mice provides an instructive example: initially reported as highly selective for cycloheximide, it was later shown to respond to multiple bitter compounds when tested in a more sensitive assay system . Similarly, for rat Tas2r114, careful comparison of assay conditions and systematic testing with appropriate controls can help resolve apparent contradictions between different experimental approaches.

What are the most common technical challenges in heterologous expression of recombinant rat Tas2r114 and how can they be overcome?

Researchers working with recombinant rat Tas2r114 frequently encounter these technical challenges:

  • Low surface expression issues:

    ChallengeSolutionValidation Method
    Poor membrane traffickingN-terminal rhodopsin tag (first 39 amino acids)Immunofluorescence, ELISA
    Protein misfoldingReduce culture temperature (30°C instead of 37°C)Functional response amplitude
    Rapid degradationProteasome inhibitors (MG132) for short-term studiesWestern blot of total vs. surface protein
    Low translation efficiencyCodon optimization for expression systemqRT-PCR vs. protein level comparison
  • Signal detection optimization:

    • Use Gα16gust44 chimeric G protein for enhanced coupling efficiency

    • Consider BRET-based assays for improved sensitivity over calcium imaging

    • Implement automated fluid handling for precise compound addition

    • Optimize cell density (70-80% confluence optimal for most assays)

  • Agonist screening challenges:

    • Solubility issues: Prepare stock solutions in DMSO (final DMSO <0.1%)

    • Compound stability: Prepare fresh solutions for unstable compounds

    • Autofluorescence: Account for compound fluorescence in analysis

    • Non-specific effects: Include non-transfected cell controls

  • Reproducibility factors:

    • Cell passage number affects receptor expression (use cells between passages 5-15)

    • Transfection efficiency variation (use internal transfection markers)

    • Receptor desensitization (allow sufficient recovery between stimulations)

    • Proper vehicle controls for all test compounds

By systematically addressing these technical challenges, researchers can improve the reliability and sensitivity of heterologous expression systems for rat Tas2r114 functional characterization.

What emerging technologies will advance our understanding of rat Tas2r114 structure and function?

Several cutting-edge technologies are poised to transform Tas2r114 research:

  • Structural biology innovations:

    • Cryo-EM approaches similar to those used for human TAS2R14

    • Computational methods for predicting ligand-receptor interactions

    • Advanced molecular dynamics simulations of membrane-embedded receptors

    • Integration of AlphaFold2 predictions with experimental structural data

  • Single-cell technologies:

    TechnologyApplication to Tas2r114 ResearchPotential Insights
    scRNA-seqCell-type specific expression patternsNovel expressing cell populations
    Spatial transcriptomicsPositional information in tissuesFunctional microdomains
    CyTOF/CITE-seqProtein-level quantificationCorrelation with other signaling components
    Live-cell imagingReal-time signaling dynamicsTemporal signaling patterns
  • Physiological assessment tools:

    • Genetically encoded calcium indicators in specific cell types

    • Optogenetic manipulation of Tas2r114-expressing cells

    • Tissue-specific conditional knockout models

    • Organoid cultures from Tas2r114-expressing tissues

  • Translational applications:

    • Drug screening platforms using recombinant Tas2r114

    • Bioengineered sensors for environmental bitter compounds

    • Therapeutic targeting of extraoral Tas2r114 functions

    • Comparative medicine approaches across species

These emerging technologies will enable researchers to address fundamental questions about Tas2r114 function in both gustatory and extraoral contexts, potentially revealing novel physiological roles and therapeutic applications.

How can systems biology approaches integrate Tas2r114 function into broader physiological contexts?

Systems biology approaches offer powerful frameworks for understanding Tas2r114 within larger physiological networks:

  • Multi-omics integration:

    • Transcriptomics of Tas2r114-expressing tissues under various conditions

    • Proteomics to identify interaction partners and signaling complexes

    • Metabolomics to discover endogenous ligands and metabolic impacts

    • Integration of datasets to build predictive network models

  • Pathway analysis approaches:

    ApproachApplicationExpected Outcome
    ChIP-seq/ATAC-seqRegulatory mechanismsTranscriptional control elements
    PhosphoproteomicsSignaling cascadesNovel pathway components
    InteractomicsProtein-protein interactionsRegulatory protein complexes
    Flux analysisMetabolic consequencesSystem-level responses
  • Mathematical modeling:

    • Kinetic models of Tas2r114 signaling dynamics

    • Agent-based models of tissue-level responses

    • Pharmacokinetic/pharmacodynamic models for in vivo effects

    • Machine learning approaches to predict ligand interactions

  • Integrative physiological assessment:

    • Correlation of taste sensitivity with metabolic parameters

    • Effects of Tas2r114 activation on organ system functions

    • Interactions between taste perception and gut hormone signaling

    • Neural circuit mapping of Tas2r114-mediated responses

By implementing these systems approaches, researchers can move beyond reductionist views of Tas2r114 function to understand its role in integrated physiological processes and potential involvement in pathological conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.