Recombinant Rat Taste receptor type 2 member 119 (Tas2r119)

Shipped with Ice Packs
In Stock

Description

Production and Characteristics of Recombinant Tas2r119

Recombinant Rat Tas2r119 is produced through molecular cloning and protein expression techniques, yielding purified protein for research applications. Commercial preparations typically provide the following specifications:

Table 1: Characteristics of Recombinant Rat Tas2r119

ParameterDescription
Product TypeRecombinant Protein
SpeciesRattus norvegicus (Rat)
UniProt AccessionQ9JKU1
Gene NamesTas2r119 (Synonyms: Tas2r1, Tas2r19)
QuantityTypically 50 μg (other quantities available)
Storage BufferTris-based buffer, 50% glycerol, optimized for protein stability
Storage Recommendations-20°C for short-term; -20°C or -80°C for extended storage
Handling NotesAvoid repeated freezing and thawing; working aliquots at 4°C for up to one week

The recombinant protein may include affinity tags to facilitate purification and detection, though the specific tag type is often determined during the production process . This purified form allows researchers to study the receptor's properties in isolation from other cellular components.

Expression Patterns and Tissue Distribution

Research has revealed that Tas2r119, like other bitter taste receptors, exhibits expression beyond the oral cavity, with significant presence in various segments of the gastrointestinal tract. This extra-oral expression suggests functions extending beyond traditional taste perception.

Studies have employed quantitative PCR techniques with specific primers (such as Rn00576950_s1) to measure Tas2r119 gene expression in different tissues . This research has demonstrated that Tas2r119 is expressed in multiple intestinal segments, with notable presence in the jejunum and colon .

The expression pattern of Tas2r119 shows responsiveness to dietary factors. For example, a study analyzing the impact of insect consumption on taste receptor expression found that rats in a Buffalo-supplemented group exhibited significantly lower relative expression levels of Tas2r119 in the ascending colon compared to the control group . This dietary modulation suggests that Tas2r119 may play a role in the gut's adaptation to different food components.

Table 2: Expression of Tas2r119 in Rat Gastrointestinal Segments

Intestinal SegmentExpression PatternDietary ModulationReferences
JejunumDetectedExpression identified as a significant variable modulated by insect supplementation
Ascending ColonDetectedSignificantly lower expression in Buffalo-supplemented groups compared to control
Colon (general)Reported expressionNot specified

Machine learning analyses employing Elastic Net, PLS-DA, and Random Forest methodologies have identified Tas2r119 expression in both the jejunum and ascending colon as key variables that effectively distinguish between control and experimental groups receiving dietary supplementation . This finding underscores the receptor's significance in intestinal function and its responsiveness to nutritional factors.

Cell Surface Expression and Functional Properties

Immunocytochemistry studies have demonstrated that Tas2r119, when expressed in heterologous systems, exhibits clear cell surface localization both before and after cell permeabilization . This proper membrane trafficking is essential for the receptor's function, as it must be positioned at the cell surface to interact with extracellular ligands.

Table 3: Cell Surface Expression of Selected Taste Receptors Including Tas2r119

ReceptorBefore permeabilizationAfter permeabilization
Tas2r102+
Tas2r105++
Tas2r106++
Tas2r108++
Tas2r114++
Tas2r118++
Tas2r119++
Tas2r120++
Tas2r121++
Tas2r123++
Tas2r126++
Tas2r129++
Tas2r131+
Tas2r134++
Tas2r144++
Mock

Source: Data adapted from comprehensive analysis of mouse bitter taste receptors

While specific agonist profiles for rat Tas2r119 are not fully characterized in the provided research, studies on related bitter taste receptors have shown considerable variation in their tuning properties. Some receptors function as generalists, responding to a wide range of bitter compounds, while others act as specialists with narrower ligand specificity . This functional diversity likely reflects evolutionary adaptations to detect various potentially harmful substances while maintaining specificity for particular compound classes.

Functional Roles in Intestinal Physiology

The expression of Tas2r119 throughout the gastrointestinal tract suggests several potential physiological functions:

Nutrient Sensing and Dietary Adaptation

Research indicates that Tas2r119 expression is modulated by dietary components, particularly protein sources. Studies involving rats supplemented with insect protein (Buffalo or Tenebrio) revealed altered expression patterns of Tas2r119 in different intestinal segments . The consistent identification of Tas2r119 expression as a key variable distinguishing between control and supplemented groups suggests its involvement in sensing specific dietary components and potentially mediating adaptive responses in gut function.

Inflammatory Response Regulation

Some research has examined Tas2r119 expression under inflammatory conditions, including lipopolysaccharide (LPS)-induced inflammation . While the specific relationship between Tas2r119 and inflammatory processes requires further investigation, the receptor may participate in signaling pathways that regulate intestinal inflammatory responses.

Intestinal Homeostasis

The presence of Tas2r119 in various intestinal segments suggests potential roles in maintaining gut homeostasis, possibly through regulating secretory functions, motility, or interactions with the gut microbiota. The modulation of its expression by dietary factors indicates a dynamic role in adapting intestinal function to changing nutritional environments.

Comparative Analysis with Other Taste Receptors

Tas2r119 is part of a larger family of bitter taste receptors that shows considerable diversity across species. Comparative analysis provides important context for understanding its evolutionary relationships and functional significance.

Table 4: Comparative Nomenclature of Selected Bitter Taste Receptors

HumanRatMouse
TAS2R16rTAS2R3, rTas2r118mTas2r118
TAS2R19, TAS2R20/TAS2R49rTas2r36, rTas2r136mTas2r136
TAS2R30/TAS2R47rTas2r20, rTas2r120mTas2r120
TAS2R38rTas2r38, rTas2r138mTas2r138
TAS2R39rTas2r39, rTas2r139mTas2r139

Source: Data adapted from study on bitter taste receptors along the gastrointestinal tract

This table illustrates the complex relationships between bitter taste receptors across species, highlighting both the conservation of certain receptor families and the species-specific adaptations that have occurred through evolutionary processes.

The number of bitter taste receptor genes varies considerably across vertebrate species, reflecting different evolutionary pressures and adaptations to diverse ecological niches . While some species possess large numbers of taste receptor genes, others have more limited repertoires. This diversity likely relates to dietary specialization and the need to detect potentially harmful compounds in species-specific food sources.

Research Applications of Recombinant Tas2r119

Recombinant rat Tas2r119 serves as a valuable research tool for investigating various aspects of bitter taste receptor biology:

Functional Assays and Ligand Screening

The recombinant protein can be used in heterologous expression systems to identify compounds that activate Tas2r119. Such screening approaches have been successfully applied to other bitter taste receptors, combining expression in cell culture with calcium imaging or other signaling assays to detect receptor activation . These methods could reveal the specific bitter compounds recognized by Tas2r119 and provide insights into its role in detecting potentially harmful substances.

Immunological Studies

Recombinant Tas2r119 can serve as an antigen for generating specific antibodies, which are valuable tools for detecting and localizing the receptor in tissues. These antibodies facilitate immunohistochemistry, immunofluorescence, and Western blotting studies to map the distribution of Tas2r119 across different organs and cell types, providing further insights into its physiological roles.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
Tas2r119; Tas2r1; Tas2r19; Taste receptor type 2 member 119; T2R119; Taste receptor type 2 member 1; T2R1; Taste receptor type 2 member 19; T2R19
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-335
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r119
Target Protein Sequence
MMEGHILFFFLVVMVQFVTGVLANGLIVVVHAIDLIMWKKMAPLDLLLFCLATSRIILQL CILFAQLCLFSLVRHTLFEDNITFVFIINELSLWFATWLGVFYCAKIATIPHPLFLWLKM RISRLVPWLILGSVLYVIITTFIHSRETSAILKPIFISLFPKNATQVGTGHATLLSVLVL GLTLPLFIFTVAVLLLIYSLWNYSRQMRTMVGTREYSGHAHISAMLSILSFLILYLSHYM VAVLISTQVLYLGSRTFVFCLLVIGMYPSIHSIVLILGNPKLKRNAKMFIVHCKCCHCTR AWVTSRSPRLSDLPVPPTHPSANKTSCSEACIMPS
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the perception of bitter compounds in the oral cavity and gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Gene References Into Functions
  1. T2R1, a receptor for bitter taste, is expressed in the brainstem. PMID: 22836012
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the duodenum, antrum and fundus (part of the stomach).

Q&A

What is Recombinant Rat Taste receptor type 2 member 119 (Tas2r119) and how is it expressed?

Recombinant Rat Taste receptor type 2 member 119 (Tas2r119) belongs to the T2R family of G protein-coupled receptors responsible for bitter taste perception in rats. Based on comparative studies with mouse Tas2r receptors, Tas2r119 is likely expressed in taste cells located in the posterior papillae of the tongue, similar to mouse Tas2r genes which show varied expression levels across taste tissues . For determining expression patterns, quantitative RT-PCR (qRT-PCR) provides reliable measurements of relative mRNA abundance, while in situ hybridization allows visualization of cellular localization patterns . When examining expression, it's crucial to normalize receptor expression levels to established taste cell markers, such as α-gustducin, to appropriately interpret results. Expression levels of Tas2r receptors are typically reported as a percentage of α-gustducin expression, showing considerable variation among different receptor subtypes.

What experimental approaches are recommended for initial characterization of Tas2r119?

Initial characterization of Tas2r119 requires a multi-methodological approach:

  • Expression Analysis: Use qRT-PCR to quantify Tas2r119 mRNA levels in taste tissues, comparing them with other taste receptors and across different papillae types .

  • Cellular Localization: Employ in situ hybridization with specific RNA probes to identify the precise cellular localization pattern within taste buds .

  • Functional Screening: Utilize heterologous expression systems (typically HEK293T cells co-expressing chimeric G proteins like Gα16gust44) for calcium imaging assays to identify potential agonists .

  • Deorphanization: Screen against a diverse bitter compound library to determine the receptor's tuning profile and specificity .

Always include appropriate positive controls (receptors with known ligands) and negative controls (untransfected cells or cells expressing unrelated receptors) to validate experimental results.

How should research data on Tas2r119 be systematically presented?

When presenting Tas2r119 research data, follow these methodological guidelines:

Table 1: Recommended Data Presentation Approaches for Tas2r119 Research

Data TypeRecommended FormatStatistical AnalysisVisualization
Expression levelsNormalized values (% of reference gene)Descriptive statistics (mean, SD, SEM)Bar charts with error bars
Response profilesEC50 values and threshold concentrationsDose-response curve fittingConcentration-response curves
Agonist specificityTable of compounds with response magnitudesComparative statisticsHeat maps
Functional comparisonsTabulated efficacy and potency valuesANOVA with post-hoc testsForest plots

What experimental design strategies are most effective for studying Tas2r119 activation patterns?

For robust investigation of Tas2r119 activation patterns, implement a systematic experimental design that controls for key variables:

  • Full Factorial Design: When testing multiple factors affecting Tas2r119 activation (e.g., compound concentration, pH, temperature), use a full factorial design to capture interaction effects .

  • Randomized Block Design: Group experiments to control for day-to-day variability in cell responsiveness or transfection efficiency .

  • Dose-Response Relationship: Establish complete concentration-response curves using a minimum of 6-8 concentrations spanning at least 3 orders of magnitude .

  • Receptor Specificity Controls: Include closely related Tas2r subtypes to establish specificity profiles of test compounds .

Table 2: Experimental Design Considerations for Tas2r119 Functional Studies

Design ElementImplementationAdvantagePotential Pitfall
Independent variablesCompound identity, concentration, pHSystematic parameter testingIncreased complexity
Dependent variablesCalcium flux, reporter gene activityMultiple readouts for confirmationDifferent sensitivities
Extraneous variablesCell passage number, transfection efficiencyControl for technical variabilityRequires additional controls
RandomizationRandom assignment of treatment conditionsMinimizes systematic biasMore complex execution
ReplicationMinimum 3 independent experimentsStatistical robustnessResource intensive

This design approach allows for rigorous hypothesis testing and minimizes confounding variables that could affect interpretation of Tas2r119 activation data .

How can concentration-response relationships for Tas2r119 be accurately established and analyzed?

Establishing reliable concentration-response relationships for Tas2r119 requires methodological precision and appropriate analytical approaches:

  • Stimulus Preparation: Prepare stock solutions of test compounds in appropriate vehicles (typically DMSO), ensuring final DMSO concentrations remain below 0.1% to avoid non-specific effects.

  • Serial Dilutions: Use half-logarithmic or third-logarithmic dilution series to efficiently cover the dynamic response range .

  • Normalization Methods: Normalize responses to positive controls run in parallel to account for day-to-day variations in cell responsiveness .

  • Curve Fitting: Apply non-linear regression analysis using the four-parameter logistic equation to determine EC50 values and Hill coefficients.

For data analysis, follow these guidelines:

This approach allows for precise determination of potency (EC50) and efficacy (maximum response) parameters for Tas2r119 agonists, facilitating comparisons across different compounds and experimental conditions .

What are the challenges in heterologous expression systems for Tas2r119 and how can they be overcome?

Heterologous expression systems present several challenges when studying Tas2r119:

  • Variable Expression Levels: Tas2r receptors often express poorly in heterologous systems, complicating functional analyses.

  • Signal Transduction Coupling: Native G protein coupling (gustducin) may not be recapitulated in heterologous systems.

  • System-Dependent Sensitivity: Different expression systems may yield varying sensitivity profiles, as observed with mouse Tas2r105 which shows differential responses depending on the G protein used (Gα15 vs. Gα16gust44) .

  • Receptor Trafficking: Taste receptors may not traffic efficiently to the plasma membrane in non-native cells.

Table 3: Strategies to Optimize Heterologous Expression of Tas2r119

ChallengeOptimization StrategyValidation Method
Poor surface expressionUse N-terminal tags (e.g., SST or Lucy)Immunofluorescence/Flow cytometry
Weak coupling to endogenous G proteinsCo-express chimeric G proteins (Gα16gust44)Comparative calcium assays
Low signal-to-noise ratioUse FLIPR-based high-throughput assaysZ-factor calculation
Cell line variabilityTest multiple cell backgrounds (HEK293T, CHO)Systematic comparison
Constitutive activityInclude inverse agonist controlsBasal activity measurement

Research from mouse Tas2r studies indicates that the choice of G protein is critical for detection sensitivity, with Gα16gust44 providing higher sensitivity than Gα15 for some agonists . For optimal results, expression systems should be carefully selected and validated for each specific experimental objective.

How can interactions between Tas2r119 and other taste receptors be investigated?

Investigating Tas2r119 interactions with other taste receptors requires specialized experimental designs that address both physical and functional interactions:

  • Co-expression Studies: Systematically co-express Tas2r119 with other Tas2r subtypes to identify potential heteromeric interactions that might alter response profiles.

  • Dominant-Negative Approaches: Use mutated versions of Tas2r119 to determine if they interfere with the function of other co-expressed receptors.

  • Bioluminescence Resonance Energy Transfer (BRET): Employ BRET to investigate physical proximity between differentially tagged receptors in live cells.

  • Competitive Activation Assays: Test whether activation of Tas2r119 affects responses mediated by other co-expressed receptors and vice versa.

When designing these experiments, it's critical to ensure consistent expression levels across conditions and to include appropriate controls for receptor functionality. Analysis should include both qualitative assessments of interaction patterns and quantitative measures of functional consequences, such as changes in EC50 values or maximum response amplitudes.

What are the most effective ways to validate Tas2r119 knockout or knockdown models?

Validating Tas2r119 knockout or knockdown models requires a comprehensive approach that addresses both molecular and functional aspects:

  • Genomic Verification: Confirm targeted modifications using PCR and sequencing to verify the precise genomic alteration.

  • Expression Analysis: Use qRT-PCR and Western blotting to confirm absence or reduction of Tas2r119 expression at mRNA and protein levels, respectively .

  • Functional Validation: Conduct calcium imaging or other functional assays with known Tas2r119 agonists to confirm loss of specific responses.

  • Behavioral Assays: Perform taste preference tests to assess behavioral consequences of Tas2r119 deletion.

  • Specificity Controls: Verify that expression of closely related Tas2r receptors remains unaffected, similar to validation approaches used for mouse Tas2r models .

For knockdown models, include quantification of knockdown efficiency and establish the relationship between expression levels and functional responses. For knockout models, ensure comprehensive characterization of potential compensatory mechanisms involving other Tas2r receptors.

How can specificity of Tas2r119 agonists be comprehensively determined?

Determining specificity of Tas2r119 agonists requires a systematic exclusion approach:

  • Receptor Panel Screening: Test candidate agonists against a panel of all functional rat Tas2r receptors expressed in the same heterologous system .

  • Structure-Activity Relationship (SAR) Analysis: Test structural analogs of identified agonists to map the molecular determinants of activation.

  • Competitive Antagonism: Use known or putative antagonists to confirm the specificity of receptor activation.

  • Receptor Mutagenesis: Create point mutations in key binding site residues to identify molecular determinants of agonist specificity.

Table 4: Framework for Analyzing Tas2r119 Agonist Specificity

Analysis LevelExperimental ApproachOutcome MeasureInterpretation
Primary screeningCalcium mobilization in transfected cellsSignal amplitude, EC50Initial activity profile
Cross-receptor testingParallel testing on all Tas2r subtypesActivation patternReceptor selectivity profile
Dose-response characterizationSerial dilution seriesEC50, threshold concentrationPotency comparison
Structural analysisTesting of structural analogsStructure-activity relationshipPharmacophore identification
Molecular modelingDocking simulations, MDBinding energy, interaction sitesBinding mode prediction

This hierarchical approach allows for comprehensive characterization of agonist specificity and can identify compounds that are uniquely specific to Tas2r119 versus those that activate multiple Tas2r subtypes, as has been demonstrated for mouse bitter taste receptors .

How does rat Tas2r119 compare functionally with mouse and human orthologous receptors?

Comparative analysis of rat Tas2r119 with mouse and human orthologous receptors provides valuable evolutionary and functional insights:

Based on studies of mouse bitter taste receptors, we can expect rat Tas2r119 to show species-specific differences in ligand specificity and sensitivity compared to its orthologs . Mouse Tas2r receptors exhibit varying degrees of tuning breadth, from generalist receptors that respond to many compounds to specialist receptors with highly specific ligand profiles . Similar patterns likely exist across rat Tas2r receptors, including Tas2r119.

When conducting comparative analyses:

  • Sequence Homology Analysis: Align protein sequences to identify conserved and divergent regions potentially involved in ligand binding.

  • Pharmacological Profiling: Test identical compound libraries against orthologous receptors under standardized conditions.

  • Chimeric Receptor Approach: Create chimeras between rat Tas2r119 and its orthologs to map domains responsible for species-specific responses.

  • Expression Pattern Comparison: Compare tissue expression patterns across species using equivalent methodologies .

The comparative approach should account for differences in experimental systems and ensure that all receptors are expressed at comparable levels to avoid confounding functional differences with expression differences.

What are the recommended approaches for studying Tas2r119 in native tissue versus heterologous systems?

Studying Tas2r119 in native tissues versus heterologous systems presents distinct challenges and advantages:

Table 5: Comparative Analysis of Experimental Systems for Tas2r119 Research

ParameterNative Tissue (e.g., taste buds)Heterologous System (e.g., HEK293T)Methodological Considerations
Physiological relevanceHigh - includes all native componentsLimited - artificial environmentValidation of heterologous findings in native tissue
Experimental controlLimited - complex tissue environmentHigh - defined component systemUse of specific inhibitors in native tissue
Signal detectionChallenging - mixed cell populationStraightforward - homogeneous populationSignal normalization strategies
Receptor isolationDifficult - co-expression of multiple receptorsPossible - single receptor expressionInclusion of receptor-negative controls
ThroughputLow - limited tissue availabilityHigh - scalable cell culturePrioritization of key findings for native validation

When transitioning between systems:

  • Validation Pipeline: Establish a systematic approach where initial discoveries in heterologous systems are validated in progressively more native contexts.

  • Signal Normalization: Develop normalization strategies to compare responses across different experimental platforms.

  • Pharmacological Fingerprinting: Establish a fingerprint of responses to a standard set of compounds that can be used to validate receptor identity across systems.

Evidence from mouse Tas2r studies shows that receptors can exhibit different pharmacological profiles depending on the experimental system, emphasizing the importance of cross-system validation .

What emerging technologies could advance Tas2r119 research?

Emerging technologies that could significantly advance Tas2r119 research include:

  • CRISPR-Cas9 Gene Editing: Enables precise genomic modifications to create knock-in reporters or conditional knockout models of Tas2r119.

  • Single-Cell RNA Sequencing: Provides comprehensive expression profiling of Tas2r119 in heterogeneous taste bud populations.

  • Cryo-EM and Structural Biology: Could reveal the three-dimensional structure of Tas2r119, facilitating structure-based drug design.

  • Organoid Models: Development of taste bud organoids could provide more physiologically relevant experimental systems than current heterologous models.

  • Optogenetic and Chemogenetic Tools: Allow for temporal control of Tas2r119 activation in specific cell populations.

These technologies can address current limitations in Tas2r119 research, such as the lack of structural information and the challenges of studying receptor function in native cellular contexts.

How can contradictory data about Tas2r119 function be reconciled and analyzed?

When faced with contradictory data about Tas2r119 function, apply these methodological approaches:

  • Systematic Meta-Analysis: Compile all available data on Tas2r119 function and analyze methodological differences that might explain contradictions.

  • Standardized Protocols: Develop and implement standardized protocols for Tas2r119 functional assays to minimize method-dependent variations.

  • Multi-Laboratory Validation: Establish collaborations for independent validation of key findings across different laboratories.

  • Parameter Space Mapping: Systematically explore experimental parameters (e.g., temperature, pH, ionic conditions) to identify condition-dependent effects.

  • Computational Modeling: Develop in silico models that can integrate diverse experimental data and generate testable hypotheses to resolve contradictions.

When analyzing contradictory data, consider the experimental system used (similar to observations with mouse Tas2r105, which showed different responses depending on the G protein used) , the specific methodologies employed, and potential differences in receptor constructs or expression levels that might influence functional outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.