Recombinant Rat Taste receptor type 2 member 123 (Tas2r123)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant Rat Tas2r123

Recombinant Rat Tas2r123 is produced through heterologous expression systems, typically in E. coli or cell-free platforms . Key structural and biochemical properties include:

PropertyDetails
Amino Acid SequenceFull-length (1-333 aa) with conserved bitter receptor motifs .
TagN-terminal or C-terminal 6×His tag for purification .
Purity≥85–90% (determined by SDS-PAGE) .
Molecular Weight~37 kDa (predicted for unmodified protein) .
StorageLyophilized powder or liquid at -20°C/-80°C; reconstituted in Tris/PBS .

The receptor shares orthology with mouse and human TAS2Rs, particularly in transmembrane domains critical for ligand binding .

Functional Role in Bitter Signal Transduction

Tas2r123 functions as a G-protein coupled receptor (GPCR) linked to gustducin, enabling detection of bitter substances. Key mechanisms include:

  • Ligand Specificity: Activated by structurally diverse bitter compounds, including bile acids (e.g., lithocholic acid) .

  • Downstream Signaling: Couples with PLCβ2 and TRPM5 channels to mediate calcium signaling .

  • Extraoral Roles: Expressed in gastrointestinal and testicular tissues, suggesting roles in nutrient sensing and cellular homeostasis .

Bile Acid Sensitivity

Recombinant Rat Tas2r123 demonstrates activation by bile acids, with threshold concentrations in the micromolar range (Table 1) . This aligns with its hypothesized role in gut-liver signaling and detoxification pathways.

Bile AcidActivation ThresholdReceptorStudy Model
Lithocholic acid3 µMTas2r123HEK293T cells
Taurolithocholic acid1 µMTas2r108Heterologous assay

Neuroplasticity and Mitochondrial Regulation

A 2025 study revealed that Tas2r123 modulates mitochondrial organization and neuroplasticity in rodent models. Resveratrol, a polyphenol, was shown to exert antidepressant effects via Tas2r123-dependent pathways, highlighting its therapeutic potential .

Antimicrobial and Metabolic Roles

Though not directly linked to Tas2r123, studies on homologous β-defensins (e.g., β-defensin 22) suggest overlapping roles in microbial defense and reproductive health, warranting further investigation .

Challenges and Future Directions

  • Low Solubility: Requires glycerol (5–50%) for stabilization .

  • Species-Specific Agonists: Cross-reactivity with human/mouse ligands remains underexplored .

  • Therapeutic Targeting: Potential for modulating metabolic or neurological disorders via Tas2r123 pathways .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a final concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference point for your preparations.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles to maintain optimal product integrity.
Tag Info
Tag type will be determined during the manufacturing process.
Please note that the tag type will be determined during the production process. If you have specific tag type preferences, please communicate them to us, and we will prioritize developing the specified tag if feasible.
Synonyms
Tas2r123; Tas2r14; Tas2r2; Tas2r23; Taste receptor type 2 member 123; T2R123; Taste receptor type 2 member 2; T2R2; Taste receptor type 2 member 23; T2R23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Rattus norvegicus (Rat)
Target Names
Tas2r123
Target Protein Sequence
MFSQKTNYSHLFTFSIIFYVEIVTGILGNGFIALVNIMDWLKRRRISTADQILTALALTR LIYVWSVLICILLLFLCPHLSMRPEMFTAIGVIWVVDNHFSIWLATCLGVFYFLKIASFS NSLFLYLKWRVKKVVLMIILISLIFLMLNISSLGMYDHFSIDVYEGNMSYNLVDSTHFPR IFLFTNSSKVFLIANSSHVFLPINSLFMLIPFTVSLVAFFVLFLSLWKHHKKMQVNAKGP RDASTMAHTKALQIGFSFLLLYAIYLLFIITGILNLDLMRCIVILLFDHISGAVFSISHS FVLILGNSKLRQATLSVLPCLRCRSKDMDTVVF
Uniprot No.

Target Background

Function
Gustducin-coupled receptor involved in the detection of bitter compounds in the oral cavity and the gastrointestinal tract. It signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Database Links
Protein Families
G-protein coupled receptor T2R family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed in the antrum and fundus (part of the stomach), duodenum and in gastric endocrine cells.

Q&A

What is Tas2r123 and what is its role in taste perception?

Tas2r123 (taste receptor, type 2, member 123) is a bitter taste receptor expressed in rats (Rattus norvegicus). It belongs to the Tas2r family of G protein-coupled receptors that mediate bitter taste sensation. These receptors function by detecting bitter compounds and initiating signaling cascades that eventually lead to taste perception. Tas2r123 has been identified as one of the receptors that responds to the natural sweetener rebaudioside A (rebA), showing higher sensitivity compared to other murine bitter taste receptors like Tas2r108 and Tas2r134 . The gene encoding this receptor (Gene ID: 287003) has been characterized with its mRNA sequence documented as NM_173336.1 and protein sequence as NP_775458.1 .

Tas2r receptors, including Tas2r123, are primarily expressed in the posterior papillae of the mouse tongue, indicating their involvement in sensing potentially harmful bitter compounds, which typically triggers aversive behavior in animals . This defensive mechanism helps animals avoid consuming potentially toxic substances, making these receptors crucial for survival.

How is Tas2r123 expressed in taste tissues and cultured cells?

Tas2r123 expression has been confirmed in the epithelium of the posterior tongue through quantitative RT-PCR (qRT-PCR) and in situ hybridization experiments . Studies have shown that all mouse Tas2r genes, including Tas2r123, are expressed in the gustatory cells of the tongue, although at varying levels. While some Tas2r mRNAs are quite abundant (reaching approximately 20% of the α-gustducin mRNA level), others are detected at much lower levels .

In cultured cell models, Tas2r123 expression has been confirmed in STC-1 cells (a mouse enteroendocrine cell line) through microarray analysis . These cells maintain stable expression of Tas2r123 and can be used as a model system to study bitter taste receptor function. The expression levels of Tas2r123 in STC-1 cells remain consistent even after exposure to bitter compounds like rebA for 2 hours, suggesting stable receptor expression under experimental conditions .

What are the key specifications of recombinant rat Tas2r123 protein?

Recombinant rat Tas2r123 protein is typically produced in mammalian cell expression systems to ensure proper folding and post-translational modifications. According to available specifications, the protein is often produced with a His-tag to facilitate purification and detection . The typical characteristics of commercially available recombinant rat Tas2r123 include:

ParameterSpecification
Expression SystemMammalian Cells
Protein TagHis
FormulationLiquid or lyophilized powder
Endotoxin Level< 1.0 EU per μg (determined by LAL method)
Purity>80%
Storage BufferPBS
Short-term Storage+4°C
Long-term Storage-20°C to -80°C

The protein corresponds to UniProt ID Q9JKF0, and its production typically requires 5-9 weeks for custom synthesis . Proper storage conditions are essential to maintain protein stability and functionality for experimental use.

How does Tas2r123 relate to other taste receptors in rodents?

Tas2r123 is one of approximately 35 putatively functional Tas2r (bitter taste receptor) genes identified in mice . These receptors show varying degrees of evolutionary conservation, with some exhibiting one-to-one orthology between species (particularly those located on mouse chromosome 15), suggesting they developed prior to the divergence of primate and rodent lineages .

In functional studies examining bitter compound recognition, Tas2r123 has been specifically identified as one of three receptors (along with Tas2r108 and Tas2r134) that respond to rebaudioside A . Among these three receptors, Tas2r123 demonstrates higher sensitivity to rebA at lower concentrations, indicating a potentially specialized role in detecting this compound .

Unlike the human bitter taste receptor repertoire, which has been extensively characterized with agonists identified for 21 of approximately 25 receptors, the mouse and rat Tas2r repertoires remain largely uncharacterized in terms of their receptive ranges . This gap in knowledge highlights the importance of further research to understand species-specific taste perception mechanisms.

How can functional screening be used to identify Tas2r123 agonists?

Functional screening for Tas2r123 agonists typically employs heterologous expression systems combined with calcium mobilization assays. A proven methodology involves transfecting HEK293T cells with the Gα16gust44 chimeric G protein (which couples bitter taste receptors to phospholipase C) and the Tas2r123 expression construct . This system allows for the measurement of intracellular calcium release upon receptor activation by potential agonists.

The screening process typically follows these steps:

  • Transfection of HEK293T cells with Tas2r123 construct and Gα16gust44

  • Loading of transfected cells with calcium-sensitive fluorescent dyes

  • Exposure to test compounds at varying concentrations

  • Real-time monitoring of changes in fluorescence intensity (ΔF/F) as an indicator of receptor activation

  • Analysis of dose-response relationships to determine potency and efficacy

In a comprehensive screening approach, researchers tested 34 different mouse Tas2r constructs with rebaudioside A and identified only three responsive receptors: Tas2r108, Tas2r123, and Tas2r134 . Further characterization through dose-response experiments revealed that while all three receptors showed similar responses at high concentrations (3 mM), Tas2r123 exhibited higher sensitivity at lower concentrations, indicating its potentially specialized role in detecting this compound .

What cellular models are appropriate for studying Tas2r123 function?

Several cellular models have been validated for studying Tas2r123 function, each with specific advantages depending on the research question:

1. HEK293T-Gα16gust44 Cells
These cells represent the gold standard for deorphanizing bitter taste receptors and characterizing their pharmacological properties. By co-expressing Tas2r123 with the chimeric G protein Gα16gust44, researchers can effectively couple receptor activation to calcium signaling pathways that can be readily measured . This system enables high-throughput screening of potential agonists and precise determination of dose-response relationships.

2. STC-1 Enteroendocrine Cells
STC-1 cells naturally express Tas2r123 along with other taste signaling components, making them a more physiologically relevant model . These cells have been used to study the effects of bitter compounds on hormone release, such as GLP-1. Microarray analysis has confirmed the expression of Tas2r123 in these cells, and their response to bitter compounds can be monitored by measuring intracellular calcium or hormone secretion .

3. Primary Taste Cells
For studies requiring the most physiologically relevant context, primary taste cells isolated from rat circumvallate papillae can be used. While technically challenging, this approach maintains the native cellular environment of Tas2r123, including its natural expression levels and the full complement of downstream signaling components .

When selecting a cellular model, researchers should consider factors such as the need for physiological relevance versus experimental control, the availability of appropriate tools for measuring responses, and the specific aspects of Tas2r123 function being investigated.

How do dose-response relationships for Tas2r123 compare to related receptors?

Dose-response studies have revealed distinctive functional properties of Tas2r123 compared to related bitter taste receptors. When exposed to increasing concentrations of rebaudioside A (rebA), Tas2r123 exhibits a characteristic response profile that differentiates it from Tas2r108 and Tas2r134 .

Key observations from dose-response experiments include:

  • At the highest testable concentration of rebA (3 mM), all three receptors (Tas2r108, Tas2r123, and Tas2r134) show similar response magnitudes.

  • At lower concentrations, Tas2r123 demonstrates higher sensitivity compared to the other two receptors, indicating a potentially specialized role in detecting rebA at physiologically relevant concentrations .

  • The dose-response curve for Tas2r123 shows a typical sigmoidal shape, with a measurable response beginning at lower concentrations than observed for Tas2r108 and Tas2r134 .

The relative change in fluorescence (ΔF/F) observed in calcium mobilization assays provides a quantitative measure of receptor activation across a range of concentrations. This data allows researchers to calculate important pharmacological parameters such as EC50 values (the concentration producing half-maximal response), which serve as indicators of receptor sensitivity .

What methods are used to validate Tas2r123 expression in tissue samples?

Validating Tas2r123 expression in tissue samples requires multiple complementary techniques to ensure reliable detection and quantification. The following methodologies have been successfully employed:

1. Quantitative RT-PCR (qRT-PCR)
This technique allows for precise quantification of Tas2r123 mRNA levels relative to reference genes such as α-gustducin. Studies have demonstrated that qRT-PCR can effectively detect Tas2r123 expression in the epithelium of the posterior tongue, providing quantitative data on its relative abundance compared to other Tas2r genes . The methodology typically involves:

  • RNA extraction from tissue samples

  • Reverse transcription to generate cDNA

  • PCR amplification with Tas2r123-specific primers

  • Quantification using fluorescent reporter molecules

  • Normalization to reference genes

2. In Situ Hybridization
This technique allows visualization of Tas2r123 mRNA localization within tissue sections, providing spatial information about its expression pattern. Studies have used in situ hybridization to demonstrate the cellular-level distribution of Tas2r123 in vallate papillae sections . The methodology involves:

  • Preparation of labeled RNA probes complementary to Tas2r123 mRNA

  • Hybridization to fixed tissue sections

  • Detection of hybridized probes

  • Microscopic visualization of staining patterns

3. Microarray Analysis
This high-throughput technique has been used to confirm Tas2r123 expression in cell lines such as STC-1 . It allows for simultaneous assessment of multiple genes, providing a comprehensive view of the taste receptor expression profile. The methodology involves:

  • RNA extraction and labeling

  • Hybridization to microarray chips containing oligonucleotide probes

  • Scanning and image analysis

  • Data normalization and statistical analysis

4. Immunohistochemistry
When suitable antibodies are available, immunohistochemistry can be used to detect Tas2r123 protein expression in tissue sections. This technique complements mRNA-based methods by confirming translation of the gene into protein and revealing its subcellular localization.

Combining these techniques provides robust validation of Tas2r123 expression, with each method offering unique advantages for addressing specific research questions.

How should experiments be designed to assess Tas2r123 activation by bitter compounds?

Designing robust experiments to assess Tas2r123 activation requires careful consideration of several factors to ensure reliable and reproducible results. A comprehensive experimental design should include:

Receptor Expression System Selection

  • Use HEK293T cells expressing both Tas2r123 and the chimeric G protein Gα16gust44 for pharmacological characterization

  • Consider stable cell lines for long-term studies to minimize transfection variability

  • Include both positive controls (known Tas2r123 agonists like rebA) and negative controls (non-transfected cells or cells expressing unrelated receptors)

Calcium Mobilization Assay Setup

  • Optimize cell density to ensure consistent responses

  • Select appropriate calcium-sensitive dyes (e.g., Fluo-4, Fura-2, or genetically encoded calcium indicators like Cameleon YC3.6)

  • Establish baseline measurements before compound application

  • Apply test compounds using automated systems to ensure precise timing

  • Monitor fluorescence changes over an appropriate time course (typically 60-120 seconds)

Dose-Response Analysis

  • Test a wide concentration range of bitter compounds (e.g., 0.01-3 mM for rebA)

  • Include at least 6-8 concentration points for accurate curve fitting

  • Perform measurements in triplicate or quadruplicate

  • Include vehicle controls to account for non-specific effects

  • Plot relative fluorescence changes (ΔF/F) against logarithmic concentration scale

Controls for Signal Specificity

  • Use receptor antagonists or blockers when available

  • Include structurally related compounds to assess receptor selectivity

  • Employ receptor mutants to identify key binding residues

  • Test for receptor-independent artifacts at high compound concentrations

Data Analysis Considerations

  • Normalize responses to maximum receptor activation

  • Calculate EC50 values to quantify receptor sensitivity

  • Perform appropriate statistical tests to compare responses across conditions

  • Consider kinetic parameters (response onset, duration, decay) in addition to peak amplitude

This comprehensive approach enables reliable assessment of Tas2r123 activation and facilitates comparison with other bitter taste receptors or across different experimental conditions.

What controls are necessary when studying Tas2r123 function in heterologous systems?

When studying Tas2r123 function in heterologous expression systems, implementing appropriate controls is crucial for experimental validity and data interpretation. The following controls should be considered:

Expression Controls

  • Empty vector transfection: Cells transfected with expression vector lacking Tas2r123 to control for vector-induced effects

  • Receptor expression verification: Western blotting or immunofluorescence to confirm Tas2r123 protein expression

  • Co-expression marker: Inclusion of fluorescent protein tag or reporter gene to identify successfully transfected cells

  • Quantification of expression levels: qRT-PCR to verify similar expression levels across experimental conditions

Functional Controls

  • Positive control receptor: Include a well-characterized bitter taste receptor (e.g., Tas2r108 with denatonium benzoate) to verify assay functionality

  • Known Tas2r123 agonist: Include rebA at a concentration known to activate the receptor (e.g., 1-3 mM) as a positive control

  • Vehicle control: Apply the solvent used for compound dissolution without the test compound

  • Non-receptor-expressing cells: Test compounds on non-transfected cells to identify non-specific responses

Signal Transduction Controls

  • G protein co-expression: Verify that the chimeric G protein (Gα16gust44) is expressed alongside Tas2r123

  • Alternative signaling readout: Use multiple assays (calcium imaging, inositol phosphate accumulation) to corroborate findings

  • Signal inhibitors: Apply phospholipase C inhibitors to confirm canonical signaling pathway involvement

  • Calcium chelators: Use BAPTA-AM to verify that observed signals are calcium-dependent

Compound-Specific Controls

  • Concentration gradient: Test multiple concentrations to establish dose-dependency

  • Compound purity verification: Use analytical methods (HPLC, mass spectrometry) to confirm test compound identity and purity

  • Structurally related compounds: Test similar molecules to establish structure-activity relationships

  • Potential contaminants: Consider testing for endotoxin or other contaminants that might affect cellular responses

Implementing these controls ensures that observed responses are specifically attributable to Tas2r123 activation and provides a robust framework for data interpretation and comparison across studies.

How can researchers address potential artifacts in Tas2r123 activation assays?

Calcium mobilization assays used to study Tas2r123 activation can be susceptible to artifacts that may confound data interpretation. Researchers should implement strategies to identify and mitigate these potential issues:

1. Addressing High-Concentration Artifacts
High concentrations of test compounds (>3 mM for rebA) can cause receptor-independent effects on cellular calcium handling . To address this:

  • Establish the highest non-artifactual concentration by testing compounds on non-transfected cells

  • Include osmolarity controls to account for effects of high solute concentrations

  • Consider alternative assays (e.g., GTP-γS binding) that may be less sensitive to these artifacts

  • Document any unusual response kinetics that might indicate non-receptor-mediated effects

2. Minimizing Fluorescent Compound Interference
Some bitter compounds have intrinsic fluorescence that can interfere with calcium indicators:

  • Measure compound autofluorescence at relevant wavelengths

  • Use ratiometric calcium indicators (e.g., Fura-2 or Cameleon YC3.6) to correct for background fluorescence

  • Consider alternative detection methods such as aequorin-based luminescence assays

  • Apply computational correction methods when appropriate

3. Controlling for Solvent Effects
Many bitter compounds require organic solvents for dissolution:

  • Keep solvent concentrations below 0.1% in final assay solutions

  • Include matched solvent controls for all test conditions

  • Test solvent alone at the highest concentration used

  • Consider alternative formulation approaches for poorly soluble compounds

4. Accounting for Cell Line Variability
Different batches or passages of cells may exhibit varying responses:

  • Use low-passage cells when possible

  • Include internal standards across experiments for normalization

  • Consider stable cell lines to reduce transfection variability

  • Document cell passage numbers and growth conditions

5. Managing Calcium Signaling Complexities
Endogenous calcium signaling pathways may complicate interpretation:

  • Pre-screen cell lines for responses to common bitter compounds

  • Consider calcium-free extracellular solutions to isolate intracellular calcium release

  • Use specific inhibitors of endogenous signaling pathways

  • Verify findings in multiple cell types when possible

By systematically addressing these potential artifacts, researchers can ensure that observed responses genuinely reflect Tas2r123 activation rather than experimental confounds, leading to more reliable and reproducible results.

What considerations should be made when selecting cell lines for Tas2r123 expression?

The choice of cell line for Tas2r123 expression studies significantly impacts experimental outcomes and data interpretation. Researchers should consider the following factors when selecting an appropriate cellular model:

Endogenous Receptor Expression

  • Screen candidate cell lines for endogenous expression of Tas2r family members

  • Verify absence of endogenous Tas2r123 to avoid confounding results

  • Consider using RNA-seq or qRT-PCR to characterize the bitter taste receptor profile of the cell line

  • Determine if the cell line expresses taste signaling components (e.g., gustducin, PLCβ2) that might influence receptor function

G Protein Coupling Efficiency

  • Evaluate expression of G proteins that couple to bitter taste receptors (e.g., Gα-gustducin)

  • Determine need for co-expression of chimeric G proteins like Gα16gust44 to facilitate signaling

  • Consider that different cell lines may have varying levels of endogenous G proteins that could affect signal strength

  • Assess the presence of endogenous RGS proteins that might modulate G protein signaling

Signal Transduction Machinery

  • Verify that the cell line possesses the calcium signaling components required for detection

  • Consider the balance of calcium pumps and channels that might affect signal kinetics

  • Evaluate endogenous phosphodiesterase activity that could impact second messenger levels

  • Assess the cell line's capacity to recover from calcium signals for repeated stimulations

Cellular Morphology and Growth Characteristics

  • Select cells with morphology suitable for imaging (if using microscopy-based assays)

  • Consider growth rate and contact inhibition properties for maintaining consistent cultures

  • Evaluate adherence properties for plate-based assays

  • Assess transfection efficiency and protein expression levels achievable in the cell line

Physiological Relevance vs. Technical Convenience

  • HEK293T cells: Offer high transfection efficiency and robust expression but lack taste cell context

  • STC-1 cells: Provide enteroendocrine context with endogenous Tas2r123 expression but may express multiple bitter receptors

  • Taste bud-derived cell lines: Offer more physiological context but may be technically challenging to culture and transfect

  • Primary taste cells: Provide the most physiologically relevant setting but present significant technical challenges

The optimal choice depends on the specific research question, with HEK293T-Gα16gust44 cells being most appropriate for pharmacological characterization and deorphanization studies , while more specialized cell types might be preferable for investigating physiological signaling mechanisms or receptor regulation in a native-like context.

How should Tas2r123 expression data from qRT-PCR be normalized and analyzed?

Proper normalization and analysis of Tas2r123 qRT-PCR data is essential for accurate quantification of expression levels and meaningful comparisons across experimental conditions. Researchers should follow these best practices:

Reference Gene Selection and Validation

  • Select multiple reference genes (at least 2-3) that show stable expression in taste tissues

  • Common reference genes include GAPDH, β-actin, and 18S rRNA, but taste-specific genes like α-gustducin may be more appropriate for taste tissue studies

  • Validate reference gene stability using algorithms such as geNorm, NormFinder, or BestKeeper

  • Calculate a normalization factor based on the geometric mean of multiple reference genes rather than relying on a single reference

Normalization Methods

  • Apply the comparative CT (2^-ΔΔCT) method for relative quantification:

    • ΔCT = CT(Tas2r123) - CT(reference gene)

    • ΔΔCT = ΔCT(experimental) - ΔCT(control)

    • Relative expression = 2^-ΔΔCT

  • For absolute quantification, generate standard curves using plasmids containing Tas2r123 sequence

  • Account for differences in amplification efficiency between Tas2r123 and reference genes

  • Consider normalization to total RNA when appropriate (especially for tissue biopsies)

Statistical Analysis Approaches

  • Perform statistical tests appropriate for the experimental design:

    • t-test for two-group comparisons

    • ANOVA with post-hoc tests for multiple group comparisons

    • Non-parametric alternatives when normality assumptions are violated

  • Report both biological and technical replicate data

  • Include appropriate measures of variability (standard deviation or standard error)

  • Consider using mixed-effects models for complex experimental designs

Interpretation Considerations

  • Interpret Tas2r123 expression levels in the context of other Tas2r family members

  • Consider the biological significance of observed differences (not just statistical significance)

  • Relate expression levels to functional data when available

  • Account for potential post-transcriptional regulation that might affect protein levels

By following these guidelines, researchers can ensure robust analysis of Tas2r123 expression data, facilitating reliable comparisons across experimental conditions and integration with functional studies.

What statistical approaches are appropriate for analyzing Tas2r123 dose-response curves?

Analyzing dose-response data for Tas2r123 requires appropriate statistical methods to accurately characterize receptor pharmacology and compare responses across experimental conditions. The following approaches are recommended:

Curve Fitting and Parameter Estimation

  • Fit dose-response data to appropriate mathematical models:

    • Four-parameter logistic (4PL) model: Y = Bottom + (Top-Bottom)/(1+10^((LogEC50-X)*HillSlope))

    • Three-parameter logistic model if Bottom or Top is constrained

    • Variable slope models to account for potential receptor cooperativity

  • Extract key pharmacological parameters:

    • EC50 (concentration producing half-maximal response)

    • Hill coefficient (slope factor, indicating cooperativity)

    • Emax (maximum response)

    • Basal response (minimum response in absence of stimulus)

  • Use nonlinear regression with appropriate weighting to account for heteroscedasticity

  • Calculate confidence intervals for all derived parameters

Comparison Between Receptors or Conditions

  • Compare EC50 values using extra sum-of-squares F test or Akaike's Information Criterion

  • Analyze Emax differences using appropriate parametric or non-parametric tests

  • Consider global fitting approaches when comparing multiple dose-response curves

  • Use constraints to test specific hypotheses about shared parameters

  • Employ bootstrap resampling to generate robust parameter distributions for comparison

Handling Partial Dose-Response Curves

  • For compounds that cannot be tested at sufficiently high concentrations due to solubility limitations or non-specific effects :

    • Clearly indicate constraints on parameter estimation

    • Consider alternative parameterization (e.g., EC20 instead of EC50)

    • Use relative potency approaches comparing to reference compounds

    • Apply Bayesian methods with informative priors when appropriate

Time-Course Data Analysis

  • For calcium mobilization assays with temporal information:

    • Analyze both peak amplitude and area under curve

    • Consider response kinetics (time to peak, decay rate)

    • Use functional data analysis approaches for comparing entire response profiles

    • Implement mixed-effects models to account for repeated measurements

Visualization Recommendations

  • Plot dose-response curves on semi-logarithmic scale

  • Include individual data points along with fitted curves

  • Show 95% confidence bands around fitted curves when possible

  • Use consistent scales when comparing multiple receptors or conditions

  • Consider heat maps for visualizing complex datasets with multiple compounds and receptors

These statistical approaches allow for robust characterization of Tas2r123 pharmacology and facilitate meaningful comparisons with other bitter taste receptors, providing insights into the receptor's specificity and sensitivity profiles.

How can researchers integrate Tas2r123 data with broader taste perception studies?

Integrating Tas2r123 molecular data with broader taste perception studies requires multidisciplinary approaches that connect receptor function to physiological and behavioral responses. Researchers can implement several strategies to achieve this integration:

Correlating Molecular and Behavioral Data

  • Compare Tas2r123 activation thresholds in cellular assays with detection thresholds in behavioral tests

  • Relate Tas2r123 dose-response characteristics to concentration-dependent aversion in rodent models

  • Analyze how Tas2r123 genetic variations might correspond to bitter taste perception differences

  • Implement brief-access taste tests to correlate Tas2r123 activation properties with immediate taste responses

Bridging In Vitro and Ex Vivo Systems

  • Develop ex vivo taste bud preparations that maintain Tas2r123 in its native cellular environment

  • Use calcium imaging in taste bud slices to link receptor activation to cellular responses

  • Apply electrophysiological recordings from taste nerves to connect receptor activation to neural coding

  • Employ tissue-specific genetic manipulations (e.g., conditional knockout models) to assess Tas2r123 contribution to taste responses

Systems Biology Approaches

  • Construct pathway models integrating Tas2r123 with downstream signaling components

  • Apply bioinformatic analyses to position Tas2r123 within the broader taste perception network

  • Use transcriptomic and proteomic data to identify co-expressed genes that might modulate Tas2r123 function

  • Develop computational models that predict bitter taste perception based on receptor activation patterns

Translational Research Strategies

  • Compare rat Tas2r123 function with its human orthologs or paralogs to identify conserved mechanisms

  • Relate findings from rodent Tas2r123 studies to human psychophysical data on bitter taste perception

  • Investigate potential extraoral roles of Tas2r123 in tissues beyond the tongue, such as the gastrointestinal tract

  • Consider implications for food acceptance, dietary choices, and potential clinical applications

Data Integration Frameworks

  • Utilize structured databases to organize findings across molecular, cellular, and behavioral levels

  • Develop standardized reporting formats to facilitate comparison across studies

  • Implement meta-analysis approaches to synthesize findings from diverse experimental paradigms

  • Consider ontology-based integration to formalize relationships between different levels of analysis

By systematically connecting Tas2r123 molecular mechanisms to broader physiological responses and behavioral outcomes, researchers can develop a more comprehensive understanding of bitter taste perception and its biological significance.

What bioinformatic approaches are useful for analyzing Tas2r123 structure-function relationships?

Bioinformatic approaches provide valuable insights into Tas2r123 structure-function relationships, especially given the challenges of obtaining experimental structures for GPCRs. The following methodologies are particularly useful:

Sequence-Based Analyses

  • Multiple sequence alignment (MSA) of Tas2r123 with other bitter taste receptors to identify conserved and variable regions

  • Analysis of evolutionary conservation patterns using tools like ConSurf or Rate4Site

  • Identification of functional motifs and domains through sequence pattern recognition

  • Detection of positive selection signals that might indicate ligand-binding regions

  • Comparison with human TAS2R orthologs to identify species-specific adaptations

Homology Modeling and Structure Prediction

  • Generate three-dimensional models of Tas2r123 using template-based approaches

  • Implement tools like AlphaFold2 or RoseTTAFold for AI-based structure prediction

  • Validate structural models through energy minimization and Ramachandran plot analysis

  • Refine models using molecular dynamics simulations

  • Identify potential binding pockets and functional sites through cavity analysis

Ligand-Receptor Interaction Prediction

  • Perform molecular docking of known Tas2r123 agonists (e.g., rebA) to predict binding modes

  • Implement pharmacophore modeling to identify key features for agonist recognition

  • Use fragment-based approaches to map interaction hotspots

  • Apply machine learning algorithms to predict structure-activity relationships

  • Conduct virtual screening to identify potential novel ligands for experimental validation

Functional Site Prediction and Analysis

  • Identify potential G protein coupling interfaces based on conserved motifs

  • Predict post-translational modification sites that might regulate receptor function

  • Analyze transmembrane topology and membrane-facing residues

  • Identify residues potentially involved in receptor dimerization

  • Map putative allosteric binding sites that might modulate receptor function

Network Analysis and Pathway Integration

  • Construct protein-protein interaction networks involving Tas2r123

  • Identify structural determinants of signaling specificity through comparative analysis

  • Predict co-evolutionary relationships that might indicate functional coupling

  • Integrate structural predictions with expression data and functional annotations

  • Develop systems biology models that connect structural features to cellular responses

These bioinformatic approaches complement experimental studies by generating testable hypotheses about Tas2r123 structure-function relationships, guiding targeted mutagenesis experiments, and providing a framework for interpreting functional data in a structural context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.